Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Mouse anti-Human KXD1 Monoclonal Antibody | anti-KXD1 antibody
KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP)
Gene Names
KXD1; KXDL; BORCS4; MST096; MSTP096; C10orf50; C19orf50
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KXD1; Monoclonal Antibody; KXD1 (KxDL Motif-containing Protein 1; C19orf50; DKFZp686B1038; FLJ25480; FLJ43375; MGC2749; MST096; MSTP096; UPF0459 Protein C19orf50) (AP); anti-KXD1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C9
Specificity
Recognizes human MGC2749.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KXD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-177 from human MGC2749 (NP_076974) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.67kD).)
Product Categories/Family for anti-KXD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.1 kDa (199aa), confirmed by MALDI-TOF
NCBI Official Full Name
kxDL motif-containing protein 1
NCBI Official Synonym Full Names
KxDL motif containing 1
NCBI Official Symbol
KXD1
NCBI Official Synonym Symbols
KXDL; BORCS4; MST096; MSTP096; C10orf50; C19orf50
NCBI Protein Information
kxDL motif-containing protein 1
UniProt Protein Name
KxDL motif-containing protein 1
Protein Family
UniProt Gene Name
KXD1
UniProt Synonym Gene Names
C19orf50
UniProt Entry Name
KXDL1_HUMAN
Uniprot Description
KXD1: protein of unknown function.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 19p13.11
Molecular Function: protein binding
Biological Process: vesicle-mediated transport
Research Articles on KXD1
Similar Products
Product Notes
The KXD1 kxd1 (Catalog #AAA6132308) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KXD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KXD1 kxd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KXD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
