Mouse KPNB3 Monoclonal Antibody | anti-KPNB3 antibody

KPNB3 (Importin 5, Importin-5, Imp5, Importin Subunit beta-3, Karyopherin beta-3, Ran-binding Protein 5, RanBP5, IPO5, RANBP5) (FITC)

Cat. Num. AAA6147941

• Gene Names: IPO5; IMB3; Pse1; imp5; KPNB3; RANBP5
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KPNB3; Monoclonal Antibody; KPNB3 (Importin 5; Importin-5; Imp5; Importin Subunit beta-3; Karyopherin beta-3; Ran-binding Protein 5; RanBP5; IPO5; RANBP5) (FITC); anti-KPNB3 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C4
• Specificity: Recognizes human RANBP5. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-KPNB3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human RANBP5 (AAH01497) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(RANBP5 monoclonal antibody Western Blot analysis of RANBP5 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RANBP5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RANBP5 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-KPNB3 antibody

Antibodies; Transport Proteins

References

1. Localization of retinitis pigmentosa 2 to cilia is regulated by Importin {beta}2. Hurd TW, Fan S, Margolis BL.J Cell Sci. 2011 Mar 1;124(Pt 5):718-26. Epub 2011 Feb 1.

NCBI and Uniprot Product Information

• NCBI GI #: 37589090
• NCBI GeneID: 3843
• Molecular Weight: 125,545 Da
• NCBI Official Full Name: Homo sapiens importin 5, mRNA
• NCBI Official Synonym Full Names: importin 5
• NCBI Official Symbol: IPO5
• NCBI Official Synonym Symbols: IMB3; Pse1; imp5; KPNB3; RANBP5
• NCBI Protein Information: importin-5

NCBI Description

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq, Jul 2008]