Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (84.92kD).)

Mouse anti-Human KPNA1 Monoclonal Antibody | anti-KPNA1 antibody

KPNA1 (Importin Subunit alpha-1, Karyopherin Subunit alpha-1, Nucleoprotein Interactor 1, NPI-1, RAG Cohort Protein 2, SRP1-beta, RCH2) APC

Gene Names
KPNA1; RCH2; SRP1; IPOA5; NPI-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KPNA1; Monoclonal Antibody; KPNA1 (Importin Subunit alpha-1; Karyopherin Subunit alpha-1; Nucleoprotein Interactor 1; NPI-1; RAG Cohort Protein 2; SRP1-beta; RCH2) APC; anti-KPNA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A4-1B5
Specificity
Recognizes human KPNA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KPNA1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-538 from human KPNA1 (AAH02374.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (84.92kD).)

Western Blot (WB) (Western Blot detection against Immunogen (84.92kD).)

Western Blot (WB)

(KPNA1 monoclonal antibody Western Blot analysis of KPNA1 expression in HeLa.)

Western Blot (WB) (KPNA1 monoclonal antibody Western Blot analysis of KPNA1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody. Lane 1: KPNA1 transfected lysate (60.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody. Lane 1: KPNA1 transfected lysate (60.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KPNA1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KPNA1 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-KPNA1 antibody
References
1. Targeted disruption of one of the importin ? family members leads to female functional incompetence in delivery. Moriyama T, Nagai M, Oka M, Ikawa M, Okabe M, Yoneda Y.FEBS J. 2011 Mar 3. doi: 10.1111/ j.1742-4658. 2011.08079.x. 2. Nuclear import impairment causes cytoplasmic trans-activation response DNA-binding protein accumulation and is associated with frontotemporal lobar degeneration. Nishimura AL, Zupunski V, Troakes C, Kathe C, Fratta P, Howell M, Gallo JM, Hortobagyi T, Shaw CE, Rogelj B.Brain. 2010 Jun;133(Pt 6):1763-71. Epub 2010 May 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
60,222 Da
NCBI Official Full Name
Homo sapiens karyopherin alpha 1 (importin alpha 5), mRNA
NCBI Official Synonym Full Names
karyopherin alpha 1 (importin alpha 5)
NCBI Official Symbol
KPNA1
NCBI Official Synonym Symbols
RCH2; SRP1; IPOA5; NPI-1
NCBI Protein Information
importin subunit alpha-5; RAG cohort protein 2; SRP1-beta; importin alpha 5; importin subunit alpha-1; importin-alpha-S1; karyopherin subunit alpha-1; nucleoprotein interactor 1; recombination activating gene cohort 2

NCBI Description

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. This protein interacts with the recombination activating gene 1 (RAG1) protein and is a putative substrate of the RAG1 ubiquitin ligase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Research Articles on KPNA1

Similar Products

Product Notes

The KPNA1 (Catalog #AAA6137333) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KPNA1 (Importin Subunit alpha-1, Karyopherin Subunit alpha-1, Nucleoprotein Interactor 1, NPI-1, RAG Cohort Protein 2, SRP1-beta, RCH2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KPNA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KPNA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KPNA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.