Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human KNTC1 Monoclonal Antibody | anti-KNTC1 antibody

KNTC1 (Kinetochore Associated 1, Kinetochore-associated Protein 1, FLJ36151, KIAA0166, Rough Deal Homolog, hRod, HsROD, Rod) (MaxLight 650)

Gene Names
KNTC1; ROD
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography
Synonyms
KNTC1; Monoclonal Antibody; KNTC1 (Kinetochore Associated 1; Kinetochore-associated Protein 1; FLJ36151; KIAA0166; Rough Deal Homolog; hRod; HsROD; Rod) (MaxLight 650); anti-KNTC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10H4
Specificity
Recognizes human KNTC1.
Purity/Purification
Purified by Protein A Affinity Chromatography
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
6974
Applicable Applications for anti-KNTC1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2100-2209 from KNTC1 with GST tag. Swiss/UniProt Accession: NP_055523. MW of the GST tag alone is 26kD.
Immunogen Sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of KNTC1 expression in HeLa NE usingMBS6007339.)

Western Blot (WB) (Western Blot analysis of KNTC1 expression in HeLa NE usingMBS6007339.)

Immunofluorescence (IF)

(Immunofluorescence of MBS6007339 on HeLa cell (50ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of MBS6007339 on HeLa cell (50ug/ml).)

Testing Data

(Detection limit for recombinant GST tagged KNTC1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KNTC1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-KNTC1 antibody
This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq]
Product Categories/Family for anti-KNTC1 antibody
References
1. Modulations of cell cycle checkpoints during HCV associated disease. Sarfraz S, Hamid S, Ali S, Jafri W, Siddiqui AA.BMC Infect Dis. 2009 Aug 10;9:125. 2. Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly. Chan YW, Fava LL, Uldschmid A, Schmitz MH, Gerlich DW, Nigg EA, Santamaria A.J Cell Biol. 2009 Jun 1;185(5):859-74. Epub 2009 May 25.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens kinetochore associated 1 (KNTC1), mRNA
NCBI Official Synonym Full Names
kinetochore associated 1
NCBI Official Symbol
KNTC1
NCBI Official Synonym Symbols
ROD
NCBI Protein Information
kinetochore-associated protein 1
UniProt Protein Name
Kinetochore-associated protein 1
UniProt Gene Name
KNTC1
UniProt Synonym Gene Names
KIAA0166; HsROD; Rod; hRod

NCBI Description

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq, Jul 2008]

Uniprot Description

KNTC1: Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores.

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: actin cytoskeleton; cytosol; kinetochore microtubule; nucleus; plasma membrane; spindle pole

Molecular Function: protein binding

Biological Process: cell division; mitotic cell cycle checkpoint; protein complex assembly; regulation of exit from mitosis; sister chromatid cohesion

Research Articles on KNTC1

Similar Products

Product Notes

The KNTC1 kntc1 (Catalog #AAA6222917) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KNTC1 (Kinetochore Associated 1, Kinetochore-associated Protein 1, FLJ36151, KIAA0166, Rough Deal Homolog, hRod, HsROD, Rod) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KNTC1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KNTC1 kntc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KNTC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.