Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody. Lane 1: KLRC4 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human KLRC4 Monoclonal Antibody | anti-KLRC4 antibody

KLRC4 (NKG2F, NKG2-F Type II Integral Membrane Protein, NK Cell Receptor F, NKG2-F-activating NK Receptor, FLJ17759, FLJ78582) (AP)

Gene Names
KLRC4; NKG2F; NKG2-F
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLRC4; Monoclonal Antibody; KLRC4 (NKG2F; NKG2-F Type II Integral Membrane Protein; NK Cell Receptor F; NKG2-F-activating NK Receptor; FLJ17759; FLJ78582) (AP); anti-KLRC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D10
Specificity
Recognizes human KLRC4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KLRC4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-159 from KLRC4 (AAH17784) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody. Lane 1: KLRC4 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KLRC4 expression in transfected 293T cell line by KLRC4 monoclonal antibody. Lane 1: KLRC4 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KLRC4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLRC4 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-KLRC4 antibody
May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Product Categories/Family for anti-KLRC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18,234 Da
NCBI Official Full Name
Homo sapiens killer cell lectin-like receptor subfamily C, member 4, mRNA
NCBI Official Synonym Full Names
killer cell lectin like receptor C4
NCBI Official Symbol
KLRC4
NCBI Official Synonym Symbols
NKG2F; NKG2-F
NCBI Protein Information
NKG2-F type II integral membrane protein

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene is a member of the NKG2 group of genes that are expressed primarily in natural killer (NK) cells. These family members encode transmembrane proteins that are characterized by a type II membrane orientation (have an extracellular C-terminus) and the presence of a C-type lectin domain. This family member is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. Read-through transcription exists between this gene and the downstream KLRK1 (killer cell lectin-like receptor subfamily K, member 1) family member. [provided by RefSeq, Dec 2010]

Research Articles on KLRC4

Similar Products

Product Notes

The KLRC4 (Catalog #AAA6132027) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLRC4 (NKG2F, NKG2-F Type II Integral Membrane Protein, NK Cell Receptor F, NKG2-F-activating NK Receptor, FLJ17759, FLJ78582) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLRC4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLRC4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLRC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.