Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of KLK2 transfected lysate using KLK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KLK2 rabbit polyclonal antibody.)

Mouse anti-Human KLK2 Monoclonal Antibody | anti-KLK2 antibody

KLK2 (Kallikrein-2, Glandular Kallikrein-1, hGK-1, Tissue Kallikrein-2) (Biotin)

Gene Names
KLK2; hK2; hGK-1; KLK2A2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLK2; Monoclonal Antibody; KLK2 (Kallikrein-2; Glandular Kallikrein-1; hGK-1; Tissue Kallikrein-2) (Biotin); anti-KLK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C5
Specificity
Recognizes human KLK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-KLK2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-262 from human KLK2 with GST tag. MW of the GST tag alone is 26kD. GeneBank: BC005196, AAH05196
Immunogen Sequence
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of KLK2 transfected lysate using KLK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KLK2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of KLK2 transfected lysate using KLK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KLK2 rabbit polyclonal antibody.)
Related Product Information for anti-KLK2 antibody
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Product Categories/Family for anti-KLK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,301 Da
NCBI Official Full Name
Homo sapiens kallikrein-related peptidase 2, mRNA
NCBI Official Synonym Full Names
kallikrein related peptidase 2
NCBI Official Symbol
KLK2
NCBI Official Synonym Symbols
hK2; hGK-1; KLK2A2
NCBI Protein Information
kallikrein-2
Protein Family

NCBI Description

This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012]

Research Articles on KLK2

Similar Products

Product Notes

The KLK2 (Catalog #AAA6142625) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLK2 (Kallikrein-2, Glandular Kallikrein-1, hGK-1, Tissue Kallikrein-2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.