Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KLF4 expression in transfected 293T cell line by KLF4 monoclonal antibody (M02), clone X1.Lane 1: KLF4 transfected lysate(50.1 KDa).Lane 2: Non-transfected lysate.)

Mouse KLF4 Monoclonal Antibody | anti-KLF4 antibody

KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (APC)

Gene Names
KLF4; EZF; GKLF
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
KLF4; Monoclonal Antibody; KLF4 (Kruppel-like Factor 4 (gut); EZF; GKLF) (APC); Kruppel-like Factor 4 (gut); GKLF; anti-KLF4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
X1
Specificity
Recognizes KLF4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
470
Applicable Applications for anti-KLF4 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KLF4 (AAH29923, 221aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLF4 expression in transfected 293T cell line by KLF4 monoclonal antibody (M02), clone X1.Lane 1: KLF4 transfected lysate(50.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KLF4 expression in transfected 293T cell line by KLF4 monoclonal antibody (M02), clone X1.Lane 1: KLF4 transfected lysate(50.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(KLF4 monoclonal antibody (M02), clone X1. Western Blot analysis of KLF4 expression in human colon.)

Western Blot (WB) (KLF4 monoclonal antibody (M02), clone X1. Western Blot analysis of KLF4 expression in human colon.)

Testing Data

(Detection limit for recombinant GST tagged KLF4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLF4 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KLF4 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KLF4 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KLF4 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KLF4 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-KLF4 antibody
Mouse monoclonal antibody raised against a partial recombinant KLF4.
Product Categories/Family for anti-KLF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Kruppel-like factor 4 (gut)
NCBI Official Synonym Full Names
Kruppel like factor 4
NCBI Official Symbol
KLF4
NCBI Official Synonym Symbols
EZF; GKLF
NCBI Protein Information
Krueppel-like factor 4
Protein Family

NCBI Description

This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Research Articles on KLF4

Similar Products

Product Notes

The KLF4 (Catalog #AAA6169749) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KLF4 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.