Mouse KLF12 Monoclonal Antibody | anti-KLF12 antibody

KLF12 (Kruppel-like Factor 12, AP-2rep, AP2REP, HSPC122) (PE)

Cat. Num. AAA6185869

• Gene Names: KLF12; AP2REP; AP-2rep; HSPC122
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: KLF12; Monoclonal Antibody; KLF12 (Kruppel-like Factor 12; AP-2rep; AP2REP; HSPC122) (PE); Kruppel-like Factor 12; HSPC122; anti-KLF12 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 30000
• Specificity: Recognizes KLF12.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-KLF12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: KLF12 (NP_009180, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLF12 expression in transfected 293T cell line by KLF12 monoclonal antibody (M01), clone 3E4.Lane 1: KLF12 transfected lysate(44.2 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-KLF12 antibody

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-KLF12 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 21071074
• NCBI GeneID: 11278
• NCBI Accession #: NP_009180
• NCBI GenBank Nucleotide #: NM_007249.4
• UniProt Accession #: Q9Y4X4; Q5VZM7; Q9UHZ0; A8K5T2; L0R3J4
• Molecular Weight: 46.6 kDa (425aa)
• NCBI Official Full Name: Krueppel-like factor 12
• NCBI Official Synonym Full Names: Kruppel like factor 12
• NCBI Official Symbol: KLF12
• NCBI Official Synonym Symbols: AP2REP; AP-2rep; HSPC122
• NCBI Protein Information: Krueppel-like factor 12
• UniProt Protein Name: Krueppel-like factor 12
• Protein Family: Krueppel-like factor
• UniProt Gene Name: KLF12
• UniProt Synonym Gene Names: AP2REP
• UniProt Entry Name: KLF12_HUMAN

NCBI Description

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KLF12: Confers strong transcriptional repression to the AP-2- alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter. Belongs to the Sp1 C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 13q22

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription corepressor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter