Mouse anti-Human KLF1 Monoclonal Antibody | anti-KLF1 antibody

KLF1 (EKLF, Kruppel-like Factor 1, Erythroid Krueppel-like Transcription Factor) (FITC)

Cat. Num. AAA6147910

• Gene Names: KLF1; EKLF; EKLF/KLF1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLF1; Monoclonal Antibody; KLF1 (EKLF; Kruppel-like Factor 1; Erythroid Krueppel-like Transcription Factor) (FITC); anti-KLF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 5G12
• Specificity: Recognizes human KLF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1613

• Applicable Applications for anti-KLF1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa183-237 from KLF1 (NP_006554) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB)

(KLF1 monoclonal antibody Western Blot analysis of KLF1 expression in K-562)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KLF1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KLF1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-KLF1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1732746267
• NCBI GeneID: 10661
• NCBI Accession #: NM_006563.5
• NCBI GenBank Nucleotide #: NM_006563
• UniProt Accession #: Q13351
• NCBI Official Full Name: Homo sapiens Kruppel like factor 1 (KLF1), mRNA
• NCBI Official Synonym Full Names: Kruppel like factor 1
• NCBI Official Symbol: KLF1
• NCBI Official Synonym Symbols: EKLF; EKLF/KLF1
• NCBI Protein Information: Krueppel-like factor 1
• UniProt Protein Name: Krueppel-like factor 1
• Protein Family: Krueppel-like factor
• UniProt Gene Name: KLF1
• UniProt Synonym Gene Names: EKLF; EKLF

NCBI Description

This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype. [provided by RefSeq, Oct 2009]

Uniprot Description

KLF1: Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation. Defects in KLF1 are the cause of congenital dyserythropoietic anemia type 4 (CDA4). It is a blood disorder characterized by ineffective erythropoiesis and hemolysis resulting in anemia. Circulating erythroblasts and erythroblasts in the bone marrow show various morphologic abnormalities. Affected individuals with CDA4 also have increased levels of fetal hemoglobin. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.13

Cellular Component: nuclear chromatin; nucleus

Molecular Function: transcription factor activity

Biological Process: erythrocyte differentiation; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent

Disease: Anemia, Congenital Dyserythropoietic, Type Iv; Blood Group--lutheran Inhibitor; Fetal Hemoglobin Quantitative Trait Locus 6