Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse KLF1 Monoclonal Antibody | anti-KLF1 antibody

KLF1 (Kruppel-like Factor 1 (erythroid), EKLF) (MaxLight 405)

Gene Names
KLF1; EKLF; EKLF/KLF1
Applications
Western Blot
Purity
Purified
Synonyms
KLF1; Monoclonal Antibody; KLF1 (Kruppel-like Factor 1 (erythroid); EKLF) (MaxLight 405); Kruppel-like Factor 1 (erythroid); EKLF; anti-KLF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
10000
Specificity
Recognizes KLF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-KLF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KLF1 (NP_006554, 183aa-237aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLF1 antibody
Mouse monoclonal antibody raised against a partial recombinant KLF1.
Product Categories/Family for anti-KLF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
Krueppel-like factor 1
NCBI Official Synonym Full Names
Kruppel like factor 1
NCBI Official Symbol
KLF1
NCBI Official Synonym Symbols
EKLF; EKLF/KLF1
NCBI Protein Information
Krueppel-like factor 1
UniProt Protein Name
Krueppel-like factor 1
Protein Family
UniProt Gene Name
KLF1
UniProt Synonym Gene Names
EKLF; EKLF

NCBI Description

This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype. [provided by RefSeq, Oct 2009]

Uniprot Description

KLF1: Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation. Defects in KLF1 are the cause of congenital dyserythropoietic anemia type 4 (CDA4). It is a blood disorder characterized by ineffective erythropoiesis and hemolysis resulting in anemia. Circulating erythroblasts and erythroblasts in the bone marrow show various morphologic abnormalities. Affected individuals with CDA4 also have increased levels of fetal hemoglobin. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.13

Cellular Component: nuclear chromatin; nucleus

Molecular Function: transcription factor activity

Biological Process: erythrocyte differentiation; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent

Disease: Anemia, Congenital Dyserythropoietic, Type Iv; Blood Group--lutheran Inhibitor; Fetal Hemoglobin Quantitative Trait Locus 6

Research Articles on KLF1

Similar Products

Product Notes

The KLF1 klf1 (Catalog #AAA6196396) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KLF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF1 klf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.