Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIF5B monoclonal antibody (M01), clone 2A11. Western Blot analysis of KIF5B expression in HepG2.)

Mouse KIF5B Monoclonal Antibody | anti-KIF5B antibody

KIF5B (Kinesin Family Member 5B, KINH, KNS, KNS1, UKHC) (PE)

Gene Names
KIF5B; KNS; KINH; KNS1; UKHC; HEL-S-61
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
KIF5B; Monoclonal Antibody; KIF5B (Kinesin Family Member 5B; KINH; KNS; KNS1; UKHC) (PE); Kinesin Family Member 5B; UKHC; anti-KIF5B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes KIF5B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-KIF5B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KIF5B (NP_004512.1, 864aa-962aa) partial recombinant protein with GST tag.
Immunogen Sequence
EKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGGKQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KIF5B monoclonal antibody (M01), clone 2A11. Western Blot analysis of KIF5B expression in HepG2.)

Western Blot (WB) (KIF5B monoclonal antibody (M01), clone 2A11. Western Blot analysis of KIF5B expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged KIF5B is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KIF5B is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-KIF5B antibody
Mouse monoclonal antibody raised against a partial recombinant KIF5B.
Product Categories/Family for anti-KIF5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,685 Da
NCBI Official Full Name
kinesin-1 heavy chain
NCBI Official Synonym Full Names
kinesin family member 5B
NCBI Official Symbol
KIF5B
NCBI Official Synonym Symbols
KNS; KINH; KNS1; UKHC; HEL-S-61
NCBI Protein Information
kinesin-1 heavy chain
UniProt Protein Name
Kinesin-1 heavy chain
Protein Family
UniProt Gene Name
KIF5B
UniProt Synonym Gene Names
KNS; KNS1; UKHC
UniProt Entry Name
KINH_HUMAN

Uniprot Description

KIF5B: Microtubule-dependent motor required for normal distribution of mitochondria and lysosomes. Belongs to the kinesin-like protein family. Kinesin subfamily.

Protein type: Microtubule-binding; Motor

Chromosomal Location of Human Ortholog: 10p11.22

Cellular Component: ciliary rootlet; microtubule; kinesin complex; neuron projection; membrane; endocytic vesicle; perinuclear region of cytoplasm; cytoplasm; microtubule organizing center; vesicle

Molecular Function: protein binding; plus-end-directed microtubule motor activity; microtubule binding; ATPase activity; microtubule motor activity; ATP binding

Biological Process: axon guidance; regulation of membrane potential; cellular protein metabolic process; positive regulation of potassium ion transport; vesicle transport along microtubule; positive regulation of synaptic transmission, GABAergic; cytoplasm organization and biogenesis; cytoskeleton-dependent intracellular transport; microtubule-based movement

Research Articles on KIF5B

Similar Products

Product Notes

The KIF5B kif5b (Catalog #AAA6187983) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIF5B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIF5B kif5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIF5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.