Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human KIF1C Monoclonal Antibody | anti-KIF1C antibody

KIF1C (Kinesin-like Protein KIF1C, KIAA0706, LTXS1)

Gene Names
KIF1C; LTXS1
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KIF1C; Monoclonal Antibody; KIF1C (Kinesin-like Protein KIF1C; KIAA0706; LTXS1); Anti -KIF1C (Kinesin-like Protein KIF1C; anti-KIF1C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F12
Specificity
Recognizes human KIF1C.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV
Applicable Applications for anti-KIF1C antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1004-1103 from human KIF1C (NP_006603) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KIF1C on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KIF1C on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)
Related Product Information for anti-KIF1C antibody
Motor required for the retrograde transport of Golgi vesicles to the endoplasmic reticulum. Has a microtubule plus end-directed motility.
Product Categories/Family for anti-KIF1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122,947 Da
NCBI Official Full Name
kinesin-like protein KIF1C
NCBI Official Synonym Full Names
kinesin family member 1C
NCBI Official Symbol
KIF1C
NCBI Official Synonym Symbols
LTXS1
NCBI Protein Information
kinesin-like protein KIF1C
UniProt Protein Name
Kinesin-like protein KIF1C
Protein Family
UniProt Gene Name
KIF1C
UniProt Synonym Gene Names
KIAA0706
UniProt Entry Name
KIF1C_HUMAN

NCBI Description

The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. Mutations in this gene are a cause of spastic ataxia 2, autosomal recessive. [provided by RefSeq, May 2014]

Uniprot Description

KIF1C: Motor required for the retrograde transport of Golgi vesicles to the endoplasmic reticulum. Has a microtubule plus end- directed motility. Belongs to the kinesin-like protein family. Unc-104 subfamily.

Protein type: Microtubule-binding; Motor

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: Golgi apparatus; kinesin complex; microtubule; endoplasmic reticulum

Molecular Function: protein binding; plus-end-directed microtubule motor activity; microtubule binding; ATPase activity; motor activity; ATP binding

Biological Process: vesicle-mediated transport; metabolic process; retrograde vesicle-mediated transport, Golgi to ER; cytoskeleton-dependent intracellular transport; microtubule-based movement

Disease: Spastic Ataxia 2, Autosomal Recessive

Research Articles on KIF1C

Similar Products

Product Notes

The KIF1C kif1c (Catalog #AAA6009675) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KIF1C (Kinesin-like Protein KIF1C, KIAA0706, LTXS1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIF1C can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the KIF1C kif1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPPEEVTPHP ATPARRPPSP RRSHHPRRNS LDGGGRSRGA GSAQPEPQHF QPKKHNSYPQ PPQPYPAQRP PGPRYPPYTT PPRMRRQRSA PDLKESGAAV. It is sometimes possible for the material contained within the vial of "KIF1C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.