Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to KHSRP on HeLa cell. [antibody concentration 10ug/ml].)
Mouse anti-Human KHSRP Monoclonal Antibody | anti-KHSRP antibody
KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC
Gene Names
KHSRP; p75; FBP2; KSRP; FUBP2
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KHSRP; Monoclonal Antibody; KHSRP (Far Upstream Element-binding Protein 2; FUSE-binding Protein 2; KH Type-splicing Regulatory Protein; KSRP; p75; FUBP2; MGC99676) APC; anti-KHSRP antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C10
Specificity
Recognizes human KHSRP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KHSRP antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-240 from KHSRP (NP_003676) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to KHSRP on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to KHSRP on HeLa cell. [antibody concentration 10ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KHSRP on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KHSRP on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)
Western Blot (WB)
(Western Blot detection against Immunogen (35.9kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.9kD).)
Product Categories/Family for anti-KHSRP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
far upstream element-binding protein 2 isoform 1
NCBI Official Synonym Full Names
KH-type splicing regulatory protein
NCBI Official Symbol
KHSRP
NCBI Official Synonym Symbols
p75; FBP2; KSRP; FUBP2
NCBI Protein Information
far upstream element-binding protein 2
UniProt Protein Name
Far upstream element-binding protein 2
Protein Family
UniProt Gene Name
KHSRP
UniProt Synonym Gene Names
FUBP2; FUSE-binding protein 2; KSRP
UniProt Entry Name
FUBP2_HUMAN
NCBI Description
The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]
Research Articles on KHSRP
Similar Products
Product Notes
The KHSRP khsrp (Catalog #AAA6137286) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KHSRP (Far Upstream Element-binding Protein 2, FUSE-binding Protein 2, KH Type-splicing Regulatory Protein, KSRP, p75, FUBP2, MGC99676) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KHSRP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KHSRP khsrp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KHSRP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
