Mouse anti-Human KHDRBS1 Monoclonal Antibody | anti-KHDRBS1 antibody

KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, FLJ34027, GAP-associated Tyrosine Phosphoprotein p62, p21 Ras GTPase-activating Protein-associated p62, p62, p68, Src-associated in Mitosis 68kD Protein, Sam68) (Biotin)

Cat. Num. AAA6142587

• Gene Names: KHDRBS1; p62; p68; Sam68
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KHDRBS1; Monoclonal Antibody; KHDRBS1 (KH Domain-containing; RNA-binding; Signal Transduction-associated Protein 1; FLJ34027; GAP-associated Tyrosine Phosphoprotein p62; p21 Ras GTPase-activating Protein-associated p62; p62; p68; Src-associated in Mitosis 68kD Protein; Sam68) (Biotin); anti-KHDRBS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A4
• Specificity: Recognizes human KHDRBS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1795

• Applicable Applications for anti-KHDRBS1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa176-275 from KHDRBS1 (AAH00717) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of KHDRBS1 expression in transfected 293T cell line by KHDRBS1 monoclonal antibody. Lane 1: KHDRBS1 transfected lysate (41kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KHDRBS1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KHDRBS1 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KHDRBS1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(KHDRBS1 monoclonal antibody Western Blot analysis of KHDRBS1 expression in A-431)

Product Categories/Family for anti-KHDRBS1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12653852
• NCBI GeneID: 10657
• NCBI Official Full Name: Homo sapiens KH domain containing, RNA binding, signal transduction associated 1, mRNA
• NCBI Official Synonym Full Names: KH RNA binding domain containing, signal transduction associated 1
• NCBI Official Symbol: KHDRBS1
• NCBI Official Synonym Symbols: p62; p68; Sam68
• NCBI Protein Information: KH domain-containing, RNA-binding, signal transduction-associated protein 1
• Protein Family: KH domain-containing, RNA-binding, signal transduction-associated protein

NCBI Description

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]