Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KCNQ4 monoclonal antibody Western Blot analysis of KCNQ4 expression in IMR-32)

Mouse anti-Human, Mouse KCNQ4 Monoclonal Antibody | anti-KCNQ4 antibody

KCNQ4 (KCNQ 4, DFNA2, KQT-like 4, Kv7.4, Potassium Channel KQT-like 4, Potassium Channel Subunit alpha KvLQT4, Potassium Voltage Gated Channel KQT-like Protein 4, Potassium Voltage Gated Channel KQT-like Subfamily Member 4, Potassium Voltage Gated Channel

Gene Names
KCNQ4; DFNA2; KV7.4; DFNA2A
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNQ4; Monoclonal Antibody; KCNQ4 (KCNQ 4; DFNA2; KQT-like 4; Kv7.4; Potassium Channel KQT-like 4; Potassium Channel Subunit alpha KvLQT4; Potassium Voltage Gated Channel KQT-like Protein 4; Potassium Voltage Gated Channel KQT-like Subfamily Member 4; Potassium Voltage Gated Channel; anti-KCNQ4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2H6
Specificity
Recognizes human KCNQ4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4324
Applicable Applications for anti-KCNQ4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa596-696 from KCNQ4 (NP_004691) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KCNQ4 monoclonal antibody Western Blot analysis of KCNQ4 expression in IMR-32)

Western Blot (WB) (KCNQ4 monoclonal antibody Western Blot analysis of KCNQ4 expression in IMR-32)

Western Blot (WB)

(KCNQ4 monoclonal antibody Western Blot analysis of KCNQ4 expression in NIH/3T3)

Western Blot (WB) (KCNQ4 monoclonal antibody Western Blot analysis of KCNQ4 expression in NIH/3T3)

Testing Data

(Detection limit for recombinant GST tagged KCNQ4 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNQ4 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-KCNQ4 antibody
The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-KCNQ4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens potassium voltage-gated channel subfamily Q member 4 (KCNQ4), transcript variant 1, mRNA
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily Q member 4
NCBI Official Symbol
KCNQ4
NCBI Official Synonym Symbols
DFNA2; KV7.4; DFNA2A
NCBI Protein Information
potassium voltage-gated channel subfamily KQT member 4
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 4
UniProt Gene Name
KCNQ4
UniProt Entry Name
KCNQ4_HUMAN

NCBI Description

The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNQ4: Probably important in the regulation of neuronal excitability. May underlie a potassium current involved in regulating the excitability of sensory cells of the cochlea. KCNQ4 channels are blocked by linopirdin, XE991 and bepridil, whereas clofilium is without significant effect. Muscarinic agonist oxotremorine-M strongly suppress KCNQ4 current in CHO cells in which cloned KCNQ4 channels were coexpressed with M1 muscarinnic receptors. Defects in KCNQ4 are the cause of deafness autosomal dominant type 2A (DFNA2A). DFNA2A is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the potassium channel family. KQT (TC 1.A.1.15) subfamily. Kv7.4/KCNQ4 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: voltage-gated potassium channel complex; integral to membrane; basal plasma membrane; plasma membrane

Molecular Function: potassium channel activity; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; inner ear morphogenesis; sensory perception of sound; potassium ion transport

Disease: Deafness, Autosomal Dominant 2a

Research Articles on KCNQ4

Similar Products

Product Notes

The KCNQ4 kcnq4 (Catalog #AAA6131973) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNQ4 (KCNQ 4, DFNA2, KQT-like 4, Kv7.4, Potassium Channel KQT-like 4, Potassium Channel Subunit alpha KvLQT4, Potassium Voltage Gated Channel KQT-like Protein 4, Potassium Voltage Gated Channel KQT-like Subfamily Member 4, Potassium Voltage Gated Channel reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNQ4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNQ4 kcnq4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNQ4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.