Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse KCNK1 Monoclonal Antibody | anti-KCNK1 antibody

KCNK1 (Potassium Channel, Subfamily K, Member 1, DPK, HOHO, K2p1.1, KCNO1, TWIK-1, TWIK1) (MaxLight 650)

Gene Names
KCNK1; DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
Applications
Western Blot
Purity
Purified
Synonyms
KCNK1; Monoclonal Antibody; KCNK1 (Potassium Channel; Subfamily K; Member 1; DPK; HOHO; K2p1.1; KCNO1; TWIK-1; TWIK1) (MaxLight 650); Potassium Channel; TWIK1; anti-KCNK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D7
Specificity
Recognizes KCNK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-KCNK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KCNK1 (NP_002236.1, 265aa-336aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KCNK1 antibody
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]
Product Categories/Family for anti-KCNK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,143 Da
NCBI Official Full Name
potassium channel subfamily K member 1
NCBI Official Synonym Full Names
potassium channel, subfamily K, member 1
NCBI Official Symbol
KCNK1
NCBI Official Synonym Symbols
DPK; HOHO; K2P1; KCNO1; TWIK1; K2p1.1; TWIK-1
NCBI Protein Information
potassium channel subfamily K member 1; potassium channel KCNO1; inward rectifying potassium channel protein TWIK-1; potassium inwardly-rectifying channel, subfamily K, member 1
UniProt Protein Name
Potassium channel subfamily K member 1
UniProt Gene Name
KCNK1
UniProt Synonym Gene Names
HOHO1; KCNO1; TWIK1
UniProt Entry Name
KCNK1_HUMAN

NCBI Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNK1: Weakly inward rectifying potassium channel. Homodimer (Potential). Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q42-q43

Cellular Component: voltage-gated potassium channel complex; brush border membrane; apical plasma membrane; plasma membrane; endosome

Molecular Function: inward rectifier potassium channel activity

Biological Process: response to nicotine; synaptic transmission; potassium ion transport

Research Articles on KCNK1

Similar Products

Product Notes

The KCNK1 kcnk1 (Catalog #AAA6228375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KCNK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNK1 kcnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.