Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human KAT7 Monoclonal Antibody | anti-KAT7 antibody

KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) (HRP)

Gene Names
KAT7; HBO1; HBOA; MYST2; ZC2HC7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KAT7; Monoclonal Antibody; KAT7 (Histone Acetyltransferase KAT7; Histone Acetyltransferase Binding to ORC1; Lysine Acetyltransferase 7; MOZ; YBF2/SAS3; SAS2 and TIP60 Protein 2; MYST-2; HBO1; HBOa; MYST2) (HRP); anti-KAT7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G5
Specificity
Recognizes human MYST2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3600
Applicable Applications for anti-KAT7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa512-611 from MYST2 (AAH32640) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of MYST2 expression in transfected 293T cell line by MYST2 monoclonal antibody. Lane 1: MYST2 transfected lysate (70.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MYST2 expression in transfected 293T cell line by MYST2 monoclonal antibody. Lane 1: MYST2 transfected lysate (70.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of MYST2 over-expressed 293 cell line, cotransfected with MYST2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MYST2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of MYST2 over-expressed 293 cell line, cotransfected with MYST2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MYST2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-KAT7 antibody
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
Product Categories/Family for anti-KAT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Homo sapiens MYST histone acetyltransferase 2, mRNA
NCBI Official Synonym Full Names
lysine acetyltransferase 7
NCBI Official Symbol
KAT7
NCBI Official Synonym Symbols
HBO1; HBOA; MYST2; ZC2HC7
NCBI Protein Information
histone acetyltransferase KAT7
UniProt Protein Name
Histone acetyltransferase KAT7
Protein Family
UniProt Gene Name
KAT7
UniProt Synonym Gene Names
HBO1; HBOa; MYST2; MYST-2
UniProt Entry Name
KAT7_HUMAN

NCBI Description

The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. [provided by RefSeq, Oct 2016]

Uniprot Description

MYST2: a histone acetyltransferase that participates in DNA replication and the loading of the minichromosome maintenance (Mcm) complex onto chromatin. Is required for origin recognition complex (Orc) formation and replication licensing, and is responsible for much of the acetylation of histone H4. Interacts with MCM2 and ORC1L. Phosphorylated by Cdc2 during mitosis, creating a site that recruits Plk1, which in turn phosphorylates MYST2. Its phosphorylation by Plk1 during mitosis may be required for the formation of the prereplicative complex. Interacts with the androgen receptor (AR) in the presence of dihydrotestosterone. Specifically represses AR-mediated transcription.

Protein type: EC 2.3.1.48; Transcription, coactivator/corepressor; Acetyltransferase; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleoplasm; cytoplasm; nucleolus; histone acetyltransferase complex

Molecular Function: protein binding; histone acetyltransferase activity; zinc ion binding; transcription factor activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; DNA replication

Research Articles on KAT7

Similar Products

Product Notes

The KAT7 kat7 (Catalog #AAA6153681) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KAT7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KAT7 kat7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KAT7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.