Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Kallikrein 13 Monoclonal Antibody | anti-KLK13 antibody

Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 650)

Gene Names
KLK13; KLKL4; KLK-L4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Kallikrein 13; Monoclonal Antibody; Kallikrein 13 (KLK13; Kallikrein-related Peptidase 13; Kallikrein-like Protein 4; KLKL4; KLK-L4; DKFZp586J1923) (MaxLight 650); anti-KLK13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G9
Specificity
Recognizes human KLK13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-KLK13 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa179-278 from human KLK13 (NP_056411) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLK13 antibody
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. Expression of KLK13 is regulated by steroid hormones and may be useful as a marker for breast cancer.
Product Categories/Family for anti-KLK13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.3 kDa (284aa)
NCBI Official Full Name
kallikrein-13 isoform 1
NCBI Official Synonym Full Names
kallikrein related peptidase 13
NCBI Official Symbol
KLK13
NCBI Official Synonym Symbols
KLKL4; KLK-L4
NCBI Protein Information
kallikrein-13
UniProt Protein Name
Kallikrein-13
Protein Family
UniProt Gene Name
KLK13
UniProt Synonym Gene Names
KLKL4; KLK-L4
UniProt Entry Name
KLK13_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. [provided by RefSeq, Jan 2017]

Uniprot Description

KLK13: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]

Protein type: EC 3.4.21.-; Protease; Secreted; Secreted, signal peptide; Vesicle

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: cytoplasm; extracellular region; extracellular space

Molecular Function: hydrolase activity; protein binding; serine-type endopeptidase activity

Biological Process: protein processing

Research Articles on KLK13

Similar Products

Product Notes

The KLK13 klk13 (Catalog #AAA6222837) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kallikrein 13 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK13 klk13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kallikrein 13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.