Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged JSRP1 is 0.03 ng/ml as a capture antibody.)

Mouse JSRP1 Monoclonal Antibody | anti-JSRP1 antibody

JSRP1 (Junctional Sarcoplasmic Reticulum Protein 1, FLJ32416, JP-45) (Biotin)

Gene Names
JSRP1; JP45; JP-45
Applications
Western Blot
Purity
Purified
Synonyms
JSRP1; Monoclonal Antibody; JSRP1 (Junctional Sarcoplasmic Reticulum Protein 1; FLJ32416; JP-45) (Biotin); Junctional Sarcoplasmic Reticulum Protein 1; JP-45; anti-JSRP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A9
Specificity
Recognizes JSRP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-JSRP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
JSRP1 (NP_653217.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged JSRP1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged JSRP1 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-JSRP1 antibody
The sarcoplasmic reticulum (SR) is an intracellular membrane compartment that controls intracellular calcium concentration and therefore plays a role in excitation-contraction coupling. In mouse skeletal muscle, Jp45 interacts with key proteins involved in excitation-contraction coupling at the SR (Anderson et al., 2003 [PubMed 12871958]). [supplied by OMIM]
Product Categories/Family for anti-JSRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,319 Da
NCBI Official Full Name
junctional sarcoplasmic reticulum protein 1
NCBI Official Synonym Full Names
junctional sarcoplasmic reticulum protein 1
NCBI Official Symbol
JSRP1
NCBI Official Synonym Symbols
JP45; JP-45
NCBI Protein Information
junctional sarcoplasmic reticulum protein 1; 2310032K21Rik; homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45; junctional-face membrane protein of 45 kDa homolog
UniProt Protein Name
Junctional sarcoplasmic reticulum protein 1
UniProt Gene Name
JSRP1
UniProt Synonym Gene Names
JP45; JP-45
UniProt Entry Name
JSPR1_HUMAN

NCBI Description

The protein encoded by this gene is involved in excitation-contraction coupling at the sarcoplasmic reticulum. The encoded protein can interact with CACNA1S, CACNB1, and calsequestrin to help regulate calcium influx and efflux in skeletal muscle. [provided by RefSeq, Jul 2012]

Uniprot Description

JSRP1: May function as a regulator of the voltage-sensitive calcium channel CACNA1S. May regulate CACNA1S membrane targeting and activity. May function in excitation/contraction coupling in muscle cells.

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: sarcoplasmic reticulum membrane

Biological Process: skeletal muscle contraction

Research Articles on JSRP1

Similar Products

Product Notes

The JSRP1 jsrp1 (Catalog #AAA6174570) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's JSRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the JSRP1 jsrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "JSRP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.