Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ITPR1 Monoclonal Antibody | anti-ITPR1 antibody

ITPR1 (Inositol 1,4,5-trisphosphate Receptor Type 1, IP3 Receptor Isoform 1, IP3R 1, InsP3R1, Type 1 Inositol 1,4,5-trisphosphate Receptor, Type 1 InsP3 Receptor, INSP3R1) (AP)

Gene Names
ITPR1; ACV; CLA4; IP3R; IP3R1; SCA15; SCA16; SCA29; INSP3R1; PPP1R94
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITPR1; Monoclonal Antibody; ITPR1 (Inositol 1; 4; 5-trisphosphate Receptor Type 1; IP3 Receptor Isoform 1; IP3R 1; InsP3R1; Type 1 Inositol 1; 5-trisphosphate Receptor; Type 1 InsP3 Receptor; INSP3R1) (AP); anti-ITPR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B6
Specificity
Recognizes human ITPR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2695
Applicable Applications for anti-ITPR1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2470-2577 from human ITPR1 (NP_002213) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ITPR1 antibody
IP3 Receptor 1 is an intracellular channel that when stimulated by inositol 1,4,5-triphosphate mediates the release of calcium from the endoplasmic reticulum. Defects within the gene ITPR1 cause a group of cerebellar disorders known as spinocerebellar ataxia type 15 (SCA15). This receptor is widely expressed in tissue.
Product Categories/Family for anti-ITPR1 antibody
References
1. Microdomains of muscarinic acetylcholine and InsP3 receptors create InsP3 junctions and sites of Ca2+ wave initiation in smooth muscle. Olson ML, Sandison ME, Chalmers S, McCarron JG.J Cell Sci. 2012 Sep 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
inositol 1,4,5-trisphosphate receptor type 1 isoform 2
NCBI Official Synonym Full Names
inositol 1,4,5-trisphosphate receptor type 1
NCBI Official Symbol
ITPR1
NCBI Official Synonym Symbols
ACV; CLA4; IP3R; IP3R1; SCA15; SCA16; SCA29; INSP3R1; PPP1R94
NCBI Protein Information
inositol 1,4,5-trisphosphate receptor type 1
UniProt Protein Name
Inositol 1,4,5-trisphosphate receptor type 1
UniProt Gene Name
ITPR1
UniProt Synonym Gene Names
INSP3R1; IP3R 1; InsP3R1
UniProt Entry Name
ITPR1_HUMAN

NCBI Description

This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009]

Uniprot Description

IP3R1: a multi-pass endoplasmic reticulum membrane receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaMKII, eventually leading to the activation of downstream apoptosis pathways. Part of a cGMP kinase signaling complex that includes alpha-actin, calponin H1, phospholamban, PKG1 and IP3R1. Widely expressed. The receptor contains a calcium channel in its C-terminal extremity. Its large N-terminal cytoplasmic region has the ligand-binding site in the N-terminus and modulatory sites in the middle portion immediately upstream of the channel region. Phosphorylation by PKA prevents the ligand-induced opening of the calcium channels. Belongs to the ryanodine-inositol 1,4,5-triphosphate receptor ca(2+) channel (rir-cac) family. Eight alternatively spliced isoforms have been described.

Protein type: Channel, ligand-gated; Membrane protein, integral; Channel, calcium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p26.1

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum; membrane; endoplasmic reticulum; postsynaptic density; nucleolus; integral to membrane; nuclear inner membrane; platelet dense granule membrane; calcineurin complex

Molecular Function: protein binding; calcium ion transmembrane transporter activity; calcium channel inhibitor activity; intracellular ligand-gated calcium channel activity; phosphoinositide binding; inositol 1,4,5-triphosphate-sensitive calcium-release channel activity

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of calcium-mediated signaling; platelet activation; inositol phosphate-mediated signaling; voluntary musculoskeletal movement; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; signal transduction; post-embryonic development; endoplasmic reticulum calcium ion homeostasis; phospholipase C activation; calcium ion transport; release of sequestered calcium ion into cytosol; energy reserve metabolic process; response to hypoxia; innate immune response; vascular endothelial growth factor receptor signaling pathway; blood coagulation; regulation of insulin secretion

Research Articles on ITPR1

Similar Products

Product Notes

The ITPR1 itpr1 (Catalog #AAA6131933) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITPR1 (Inositol 1,4,5-trisphosphate Receptor Type 1, IP3 Receptor Isoform 1, IP3R 1, InsP3R1, Type 1 Inositol 1,4,5-trisphosphate Receptor, Type 1 InsP3 Receptor, INSP3R1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITPR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITPR1 itpr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITPR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.