Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ITPA is 3ng/ml as a capture antibody.)

Mouse anti-Human ITPA Monoclonal Antibody | anti-ITPA antibody

ITPA (Inosine Triphosphate Pyrophosphatase, ITPase, Inosine Triphosphatase, Non-canonical Purine NTP Pyrophosphatase, Non-standard Purine NTP Pyrophosphatase, Nucleoside-triphosphate Diphosphatase, Nucleoside-triphosphate Pyrophosphatase, NTPase, Putative

Gene Names
ITPA; My049; ITPase; NTPase; C20orf37; dJ794I6.3; HLC14-06-P
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITPA; Monoclonal Antibody; ITPA (Inosine Triphosphate Pyrophosphatase; ITPase; Inosine Triphosphatase; Non-canonical Purine NTP Pyrophosphatase; Non-standard Purine NTP Pyrophosphatase; Nucleoside-triphosphate Diphosphatase; Nucleoside-triphosphate Pyrophosphatase; NTPase; Putative; anti-ITPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H8
Specificity
Recognizes human ITPA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ITPA antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa88-193 from human ITPA (NP_258412) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ITPA is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITPA is 3ng/ml as a capture antibody.)
Related Product Information for anti-ITPA antibody
ITPA hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. The encoded protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency. Two transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-ITPA antibody
References
1. A novel multiparameter flow cytometric assay for inosine triphosphatase expression analysis in leukocytes. Vroemen WH, Munnix IC, Bakker JA, Bierau J, Huts M, Leers MP.Cytometry A. 2012 Apr 12. doi: 10.1002/cyto.a.22051.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.7kDa (215aa) confirmed by MALDI-TOF
NCBI Official Full Name
inosine triphosphate pyrophosphatase isoform a
NCBI Official Synonym Full Names
inosine triphosphatase
NCBI Official Symbol
ITPA
NCBI Official Synonym Symbols
My049; ITPase; NTPase; C20orf37; dJ794I6.3; HLC14-06-P
NCBI Protein Information
inosine triphosphate pyrophosphatase
UniProt Protein Name
Inosine triphosphate pyrophosphatase
UniProt Gene Name
ITPA
UniProt Synonym Gene Names
C20orf37; ITPase; Inosine triphosphatase; NTPase
UniProt Entry Name
ITPA_HUMAN

NCBI Description

This gene encodes an inosine triphosphate pyrophosphohydrolase. The encoded protein hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. This protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency which causes an accumulation of ITP in red blood cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Uniprot Description

ITPA: Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions. Defects in ITPA are the cause of inosine triphosphate pyrophosphohydrolase deficiency (ITPAD). It is a common inherited trait characterized by the abnormal accumulation of inosine triphosphate (ITP) in erythrocytes and also leukocytes and fibroblasts. The pathological consequences of ITPA deficiency, if any, are unknown. However, it might have pharmacogenomic implications and be related to increased drug toxicity of purine analog drugs. Three different human populations have been reported with respect to their ITPase activity: high, mean (25% of high) and low activity. The variant Thr-32 is associated with complete loss of enzyme activity, may be by altering the local secondary structure of the protein. Heterozygotes for this polymorphism have 22.5% of the control activity: this is consistent with a dimeric structure of the enzyme. Belongs to the HAM1 NTPase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - pyrimidine; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - purine; EC 3.6.1.19; Hydrolase

Chromosomal Location of Human Ortholog: 20p

Cellular Component: cytoplasm; cytosol

Molecular Function: metal ion binding; nucleotide binding

Biological Process: deoxyribonucleoside triphosphate catabolic process; nucleobase, nucleoside and nucleotide metabolic process; ITP catabolic process; chromosome organization and biogenesis

Disease: Inosine Triphosphatase Deficiency

Research Articles on ITPA

Similar Products

Product Notes

The ITPA itpa (Catalog #AAA6158445) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITPA (Inosine Triphosphate Pyrophosphatase, ITPase, Inosine Triphosphatase, Non-canonical Purine NTP Pyrophosphatase, Non-standard Purine NTP Pyrophosphatase, Nucleoside-triphosphate Diphosphatase, Nucleoside-triphosphate Pyrophosphatase, NTPase, Putative reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITPA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITPA itpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITPA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.