Mouse anti-Human ITM1 Monoclonal Antibody | anti-ITM1 antibody

ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A, Oligosaccharyl Transferase Subunit STT3A, STT3-A, B5, Integral Membrane Protein 1, Transmembrane Protein TMC, FLJ27038, MGC9042) (FITC)

Cat. Num. AAA6147837

• Gene Names: STT3A; TMC; ITM1; STT3-A
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ITM1; Monoclonal Antibody; ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A; Oligosaccharyl Transferase Subunit STT3A; STT3-A; B5; Integral Membrane Protein 1; Transmembrane Protein TMC; FLJ27038; MGC9042) (FITC); anti-ITM1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4D4
• Specificity: Recognizes human ITM1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 705

• Applicable Applications for anti-ITM1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa603-701 from human ITM1 (NP_689926) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody. Lane 1: ITM1 transfected lysate (80.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ITM1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-ITM1 antibody

Antibodies; Enzymes; Transferase

References

1. Keratinocyte-associated protein 2 is a bona fide subunit of the mammalian oligosaccharyltransferase. Roboti P, High S.J Cell Sci. 2012 Jan 1;125(Pt 1):220-32. Epub 2012 Jan 20.

NCBI and Uniprot Product Information

• NCBI GI #: 22749415
• NCBI GeneID: 3703
• NCBI Accession #: NP_689926
• NCBI GenBank Nucleotide #: NM_152713
• UniProt Accession #: P46977
• NCBI Official Full Name: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A isoform a
• NCBI Official Synonym Full Names: STT3 oligosaccharyltransferase complex catalytic subunit A
• NCBI Official Symbol: STT3A
• NCBI Official Synonym Symbols: TMC; ITM1; STT3-A
• NCBI Protein Information: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
• UniProt Protein Name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
• UniProt Gene Name: STT3A
• UniProt Synonym Gene Names: ITM1; TMC; Oligosaccharyl transferase subunit STT3A; STT3-A
• UniProt Entry Name: STT3A_HUMAN

NCBI Description

The protein encoded by this gene is a catalytic subunit of the N-oligosaccharyltransferase (OST) complex, which functions in the endoplasmic reticulum to transfer glycan chains to asparagine residues of target proteins. A separate complex containing a similar catalytic subunit with an overlapping function also exists. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]