Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Mouse anti-Human IRX3 Monoclonal Antibody | anti-IRX3 antibody

IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (PE)

Gene Names
IRX3; IRX-1; IRXB1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IRX3; Monoclonal Antibody; IRX3 (IRXB1; Iroquois-class Homeodomain Protein IRX-3; Homeodomain Protein IRXB1; Iroquois Homeobox Protein 3; FLJ99187) (PE); anti-IRX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D8
Specificity
Recognizes human IRX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IRX3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa182-286 from human IRX3 (NP_077312) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB)

(IRX3 monoclonal antibody. Western Blot analysis of IRX3 expression in Hela NE.)

Western Blot (WB) (IRX3 monoclonal antibody. Western Blot analysis of IRX3 expression in Hela NE.)

Western Blot (WB)

(IRX3 monoclonal antibody, Western Blot analysis of IRX3 expression in K-562.)

Western Blot (WB) (IRX3 monoclonal antibody, Western Blot analysis of IRX3 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 30ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IRX3 on HeLa cell. [antibody concentration 30ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged IRX3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IRX3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-IRX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
iroquois-class homeodomain protein IRX-3
NCBI Official Synonym Full Names
iroquois homeobox 3
NCBI Official Symbol
IRX3
NCBI Official Synonym Symbols
IRX-1; IRXB1
NCBI Protein Information
iroquois-class homeodomain protein IRX-3
UniProt Protein Name
Iroquois-class homeodomain protein IRX-3
UniProt Gene Name
IRX3
UniProt Synonym Gene Names
IRXB1
UniProt Entry Name
IRX3_HUMAN

NCBI Description

IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation of vertebrate embryos (Lewis et al., 1999 [PubMed 10370142]).[supplied by OMIM, Aug 2009]

Uniprot Description

IRX3: Transcription factor. Involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenitor factors, which are repressed by SHH signals. Involved in the transcriptional repression of MNX1 in non-motor neuron cells. Belongs to the TALE/IRO homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: axon; cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; mesoderm development; positive regulation of neuron differentiation; metanephros development

Research Articles on IRX3

Similar Products

Product Notes

The IRX3 irx3 (Catalog #AAA6158419) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IRX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRX3 irx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.