Mouse anti-Human IRF2 Monoclonal Antibody | anti-IRF2 antibody

IRF2 (IRF-2, Interferon Regulatory Factor 2) (MaxLight 550)

Cat. Num. AAA6212113

• Gene Names: IRF2; IRF-2
• Reactivity: Human
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IRF2; Monoclonal Antibody; IRF2 (IRF-2; Interferon Regulatory Factor 2) (MaxLight 550); anti-IRF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B5
• Specificity: Recognizes human IRF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-IRF2 antibody: FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa216-315 from human IRF2 (NP_002190) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of IRF2 expression in Hela NE using 128582.)

Immunohistochemistry (IHC)

(Immunoperoxidase in formalin-fixed paraffin-embedded human leiomyosarcoma usign 128582 (3ug/ml).)

Immunofluorescence (IF)

(Immunofluorescence in HeLa cells using 128582 (10ug/ml).)

Testing Data

(Detection limit for 128582 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of IRF2 expression in transfected 293T cell line by IRF2 monoclonal antibody. Lane 1: IRF2 transfected lysate (39.4kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-IRF2 antibody

Antibodies; Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 153082752
• NCBI GeneID: 3660
• NCBI Accession #: NP_002190
• NCBI GenBank Nucleotide #: NM_002199
• UniProt Accession #: P14316; Q6IAS7; Q96B99; D6RCK5; H0Y8S3
• Molecular Weight: 15 kDa (133 aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: interferon regulatory factor 2
• NCBI Official Synonym Full Names: interferon regulatory factor 2
• NCBI Official Symbol: IRF2
• NCBI Official Synonym Symbols: IRF-2
• NCBI Protein Information: interferon regulatory factor 2
• UniProt Protein Name: Interferon regulatory factor 2
• Protein Family: Interferon regulatory factor
• UniProt Gene Name: IRF2
• UniProt Synonym Gene Names: IRF-2
• UniProt Entry Name: IRF2_HUMAN

NCBI Description

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]

Uniprot Description

IRF2: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. Interacts with BRD7, IRF2BP1 and IRF2BP2. Interacts with CREBBP in growing cells; the interaction acetylates IRF2 and regulates IRF2-dependent H4 promoter activity. By viruses and IFN. Expressed throughout the epithelium of the colon. Also expressed in lamina propria. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 4q34.1-q35.1

Cellular Component: nucleoplasm; focal adhesion; cytoplasm; cytosol

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: cell proliferation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; blood coagulation