Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.94kD).)

Mouse anti-Human INPP4B Monoclonal Antibody | anti-INPP4B antibody

INPP4B (Type II Inositol 3,4-bisphosphate 4-phosphatase, Inositol Polyphosphate 4-phosphatase Type II)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
INPP4B; Monoclonal Antibody; INPP4B (Type II Inositol 3; 4-bisphosphate 4-phosphatase; Inositol Polyphosphate 4-phosphatase Type II); Anti -INPP4B (Type II Inositol 3; anti-INPP4B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F2
Specificity
Recognizes human INPP4B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
Applicable Applications for anti-INPP4B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full-length recombinant corresponding to aa1-54 from INPP4B (AAH05273) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.94kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.94kD).)

Testing Data

(Detection limit for recombinant GST tagged INPP4B is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged INPP4B is 1ng/ml as a capture antibody.)
Related Product Information for anti-INPP4B antibody
Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate.
Product Categories/Family for anti-INPP4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
104,738 Da
NCBI Official Full Name
INPP4B protein, partial
NCBI Official Synonym Full Names
inositol polyphosphate-4-phosphatase, type II, 105kDa
NCBI Official Symbol
INPP4B
NCBI Protein Information
type II inositol 3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase type II; type II inositol-3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase II; 4-phosphatase II
UniProt Protein Name
Type II inositol 3,4-bisphosphate 4-phosphatase
UniProt Gene Name
INPP4B
UniProt Entry Name
INP4B_HUMAN

NCBI Description

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

INPP4B: Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4- trisphosphate and inositol 1,4-bisphosphate. Widely expressed with highest levels occurring in the skeletal muscle and heart. Strongly inhibited by inositol hexakisphosphate. Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.

Protein type: Phosphatase, lipid; Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate; EC 3.1.3.66

Chromosomal Location of Human Ortholog: 4q31.21

Cellular Component: Golgi apparatus; cytosol

Molecular Function: phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity; lipid binding

Biological Process: cellular calcium ion homeostasis; negative regulation of osteoclast differentiation; inositol phosphate metabolic process; dephosphorylation; regulation of nucleocytoplasmic transport; phospholipid metabolic process; regulation of bone remodeling; phosphatidylinositol biosynthetic process; regulation of protein kinase B signaling cascade; signal transduction

Research Articles on INPP4B

Similar Products

Product Notes

The INPP4B inpp4b (Catalog #AAA6013499) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The INPP4B (Type II Inositol 3,4-bisphosphate 4-phosphatase, Inositol Polyphosphate 4-phosphatase Type II) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's INPP4B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the INPP4B inpp4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEIKEEGASE EGQHFLPTAQ ANDPGDCQFT SIQKTPNEPQ LEFILDLNQE LRD. It is sometimes possible for the material contained within the vial of "INPP4B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.