Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse IMPG2 Monoclonal Antibody | anti-IMPG2 antibody

IMPG2 (Interphotoreceptor Matrix Proteoglycan 2, IPM200, SPACRCAN) (MaxLight 490)

Gene Names
IMPG2; RP56; IPM200; SPACRCAN
Applications
Western Blot
Purity
Purified
Synonyms
IMPG2; Monoclonal Antibody; IMPG2 (Interphotoreceptor Matrix Proteoglycan 2; IPM200; SPACRCAN) (MaxLight 490); Interphotoreceptor Matrix Proteoglycan 2; SPACRCAN; anti-IMPG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H5
Specificity
Recognizes IMPG2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-IMPG2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IMPG2 (NP_057331.2, 572aa-678aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IMPG2 antibody
Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye. [supplied by OMIM]
Product Categories/Family for anti-IMPG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138,621 Da
NCBI Official Full Name
interphotoreceptor matrix proteoglycan 2
NCBI Official Synonym Full Names
interphotoreceptor matrix proteoglycan 2
NCBI Official Symbol
IMPG2
NCBI Official Synonym Symbols
RP56; IPM200; SPACRCAN
NCBI Protein Information
interphotoreceptor matrix proteoglycan 2; IPM 200; interphotoreceptor matrix proteoglycan IPM 200; interphotoreceptor matrix proteoglycan of 200 kDa; sialoprotein associated with cones and rods proteoglycan
UniProt Protein Name
Interphotoreceptor matrix proteoglycan 2
UniProt Gene Name
IMPG2
UniProt Synonym Gene Names
IPM200; IPM 200; Spacrcan
UniProt Entry Name
IMPG2_HUMAN

Similar Products

Product Notes

The IMPG2 impg2 (Catalog #AAA6206941) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IMPG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IMPG2 impg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IMPG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.