Mouse IL4R Monoclonal Antibody | anti-IL4R antibody

IL4R (Interleukin 4 Receptor, CD124, IL4RA) (PE)

Cat. Num. AAA6186859

• Gene Names: IL4R; CD124; IL4RA; IL-4RA
• Applications: ELISA
• Purity: Purified
• Synonyms: IL4R; Monoclonal Antibody; IL4R (Interleukin 4 Receptor; CD124; IL4RA) (PE); Interleukin 4 Receptor; IL4RA; anti-IL4R antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H8
• Specificity: Recognizes IL4R.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-IL4R antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IL4R (NP_000409, 26aa-135aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IL4R is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-IL4R antibody

This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-IL4R antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 4557669
• NCBI GeneID: 3566
• NCBI Accession #: NP_000409
• NCBI GenBank Nucleotide #: NM_000418.3
• UniProt Accession #: P24394; Q96P01; Q9H181; Q9H182; Q9H183; Q9H184; Q9H185; Q9H186; Q9H187; B4E076; B9EKU8; H3BSY5
• Molecular Weight: 24.7kDa (215aa) 28-40kDa (SDS-PAGE under reducing conditions)
• NCBI Official Full Name: interleukin-4 receptor subunit alpha isoform a
• NCBI Official Synonym Full Names: interleukin 4 receptor
• NCBI Official Symbol: IL4R
• NCBI Official Synonym Symbols: CD124; IL4RA; IL-4RA
• NCBI Protein Information: interleukin-4 receptor subunit alpha
• UniProt Protein Name: Interleukin-4 receptor subunit alpha
• Protein Family: Interleukin-4 receptor
• UniProt Gene Name: IL4R
• UniProt Synonym Gene Names: IL4RA; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; Soluble IL-4 receptor subunit alpha; Soluble IL-4R-alpha; sIL4Ralpha/prot; IL4-BP
• UniProt Entry Name: IL4RA_HUMAN

NCBI Description

This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]

Uniprot Description

IL4R: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. Belongs to the type I cytokine receptor family. Type 4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 16p12.1-p11.2

Cellular Component: extracellular space; integral to plasma membrane; receptor complex

Molecular Function: protein binding; interleukin-4 receptor activity; receptor signaling protein activity

Biological Process: ovulation; positive regulation of T-helper 2 cell differentiation; negative regulation of T-helper 1 cell differentiation; response to estrogen stimulus; production of molecular mediator of acute inflammatory response; immune response; defense response to protozoan; signal transduction; regulation of cell proliferation; positive regulation of macrophage activation

Disease: Ige Responsiveness, Atopic; Human Immunodeficiency Virus Type 1, Susceptibility To