Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human IL1A Monoclonal Antibody | anti-IL1A antibody

IL1A (Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1, IL1F1) (FITC)

Gene Names
IL1A; IL1; IL-1A; IL1F1; IL1-ALPHA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL1A; Monoclonal Antibody; IL1A (Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1; IL1F1) (FITC); anti-IL1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B8
Specificity
Recognizes human IL1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IL1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa172-271 from human IL1A (AAH13142) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of IL1A expression in transfected 293T cell line by IL1A monoclonal antibody. Lane 1: IL1A transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL1A expression in transfected 293T cell line by IL1A monoclonal antibody. Lane 1: IL1A transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged IL1A is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL1A is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-IL1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,607 Da
NCBI Official Full Name
Homo sapiens interleukin 1, alpha, mRNA
NCBI Official Synonym Full Names
interleukin 1 alpha
NCBI Official Symbol
IL1A
NCBI Official Synonym Symbols
IL1; IL-1A; IL1F1; IL1-ALPHA
NCBI Protein Information
interleukin-1 alpha
Protein Family

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008]

Research Articles on IL1A

Similar Products

Product Notes

The IL1A (Catalog #AAA6147757) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL1A (Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1, IL1F1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.