Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human IL17F Monoclonal Antibody | anti-IL17F antibody

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (FITC)

Gene Names
IL17F; ML1; ML-1; CANDF6; IL-17F
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL17F; Monoclonal Antibody; IL17F (Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL24) (FITC); anti-IL17F antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E5
Specificity
Recognizes human IL17F.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IL17F antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa31-140 from human IL17F (NP_443104) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-IL17F antibody
Interleukin 17 (IL-17) is a pro-inflammatory cytokine produced by a subset of T helper cells that develops distinct from the Th1- and Th2- cell differentiation pathways. IL-17, also known as CTLA-8, stimulates induction of other pro-inflammatory cytokines TNF alpha, IL-1 beta, IL-6, and IL-8, and reports strongly suggest the involvement of IL-17 in several chronic inflammatory diseases such as rheumatoid arthritis, psoriasis and multiple sclerosis. TGF-ß (differentiation) and IL-23 (expansion) are required for induction and maintenance of Th17 (IL-17 producing) cells, which in turn induce the other pro-inflammatory cytokines. IL-17 (~32kD) protein is produced and exists as a homo-dimer, has homology to a herpes virus early protein, is one of the six members (IL-17A-F) of this cytokine family, and is well characterzed and highly expressed by activated effector memory T cells.
Product Categories/Family for anti-IL17F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.6kDa (158aa)
NCBI Official Full Name
interleukin-17F
NCBI Official Synonym Full Names
interleukin 17F
NCBI Official Symbol
IL17F
NCBI Official Synonym Symbols
ML1; ML-1; CANDF6; IL-17F
NCBI Protein Information
interleukin-17F
UniProt Protein Name
Interleukin-17F
Protein Family
UniProt Gene Name
IL17F
UniProt Synonym Gene Names
IL-17F
UniProt Entry Name
IL17F_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq, Jul 2008]

Uniprot Description

IL17F: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Defects in IL17F are the cause of familial candidiasis type 6 (CANDF6). CANDF6 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. Belongs to the IL-17 family.

Protein type: Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: extracellular space; extracellular region

Molecular Function: protein homodimerization activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine binding; cytokine activity

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; regulation of transforming growth factor beta receptor signaling pathway; regulation of interleukin-8 biosynthetic process; lymphotoxin A biosynthetic process; cartilage development; cytokine biosynthetic process; regulation of interleukin-2 biosynthetic process; regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; regulation of interleukin-6 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Disease: Candidiasis, Familial, 6

Research Articles on IL17F

Similar Products

Product Notes

The IL17F il17f (Catalog #AAA6147754) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL17F can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL17F il17f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL17F, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.