Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse IL12B Monoclonal Antibody | anti-IL12B antibody

IL12B (Interleukin 12B (Natural Killer Cell Stimulatory Factor 2, Cytotoxic Lymphocyte Maturation Factor 2, p40), CLMF, CLMF2, IL-12B, NKSF, NKSF2) (MaxLight 650)

Gene Names
IL12B; CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Applications
Western Blot
Purity
Purified
Synonyms
IL12B; Monoclonal Antibody; IL12B (Interleukin 12B (Natural Killer Cell Stimulatory Factor 2; Cytotoxic Lymphocyte Maturation Factor 2; p40); CLMF; CLMF2; IL-12B; NKSF; NKSF2) (MaxLight 650); Interleukin 12B (Natural Killer Cell Stimulatory Factor 2; NKSF2; anti-IL12B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H6
Specificity
Recognizes IL12B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-IL12B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IL12B (NP_002178, 229aa-328aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL12B antibody
This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq]
Product Categories/Family for anti-IL12B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,169 Da
NCBI Official Full Name
interleukin-12 subunit beta
NCBI Official Synonym Full Names
interleukin 12B
NCBI Official Symbol
IL12B
NCBI Official Synonym Symbols
CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
NCBI Protein Information
interleukin-12 subunit beta; CLMF p40; IL-12 subunit p40; IL12, subunit p40; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; interleukin 12, p40; interleukin 12B (natural killer cell stimulatory factor 2, cytotox
Protein Family

Similar Products

Product Notes

The IL12B (Catalog #AAA6228203) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL12B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL12B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL12B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.