Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse IL12A Monoclonal Antibody | anti-IL12A antibody

IL12A (Interleukin 12A (Natural Killer Cell Stimulatory Factor 1, Cytotoxic Lymphocyte Maturation Factor 1, p35), CLMF, IL-12A, NFSK, NKSF1, P35) (MaxLight 750)

Gene Names
IL12A; P35; CLMF; NFSK; NKSF1; IL-12A
Applications
Western Blot
Purity
Purified
Synonyms
IL12A; Monoclonal Antibody; IL12A (Interleukin 12A (Natural Killer Cell Stimulatory Factor 1; Cytotoxic Lymphocyte Maturation Factor 1; p35); CLMF; IL-12A; NFSK; NKSF1; P35) (MaxLight 750); Interleukin 12A (Natural Killer Cell Stimulatory Factor 1; P35; anti-IL12A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A6
Specificity
Recognizes IL12A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-IL12A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IL12A (NP_000873.2, 144aa-253aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL12A antibody
This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq]
Product Categories/Family for anti-IL12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,874 Da
NCBI Official Full Name
interleukin-12 subunit alpha
NCBI Official Synonym Full Names
interleukin 12A
NCBI Official Symbol
IL12A
NCBI Official Synonym Symbols
P35; CLMF; NFSK; NKSF1; IL-12A
NCBI Protein Information
interleukin-12 subunit alpha; CLMF p35; IL35 subunit; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NF cell stimulatory factor chain 1; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lym
UniProt Protein Name
Interleukin-12 subunit alpha
Protein Family
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
NKSF1; IL-12A; CLMF p35; NKSF1
UniProt Entry Name
IL12A_HUMAN

NCBI Description

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

Uniprot Description

IL12A: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. Belongs to the IL-6 superfamily.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 3q25.33

Cellular Component: extracellular space; interleukin-12 complex; cytoplasm

Molecular Function: protein binding; interleukin-27 binding; growth factor activity; interleukin-12 beta subunit binding; protein heterodimerization activity; cytokine activity; interleukin-12 receptor binding

Biological Process: positive regulation of NK T cell activation; cell migration; positive regulation of cell adhesion; positive regulation of T cell mediated cytotoxicity; negative regulation of smooth muscle cell proliferation; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; response to virus; positive regulation of tyrosine phosphorylation of Stat4 protein; response to lipopolysaccharide; defense response to protozoan; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell activation; response to UV-B; positive regulation of interferon-gamma production; defense response to Gram-positive bacterium; negative regulation of interleukin-17 production; positive regulation of T cell differentiation; positive regulation of mononuclear cell proliferation; positive regulation of lymphocyte proliferation; positive regulation of T cell proliferation; immune response; cell cycle arrest

Research Articles on IL12A

Similar Products

Product Notes

The IL12A il12a (Catalog #AAA6238877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IL12A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL12A il12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL12A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.