Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.24kD).)

Mouse anti-Human IL11 Monoclonal Antibody | anti-IL11 antibody

IL11 (Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin) (HRP)

Gene Names
IL11; AGIF; IL-11
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL11; Monoclonal Antibody; IL11 (Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin) (HRP); anti-IL11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F1
Specificity
Recognizes human IL11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-IL11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-74 from human IL11 (NP_000632.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.24kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.24kD).)

Testing Data

(Detection limit for recombinant GST tagged IL11 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL11 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-IL11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,994 Da
NCBI Official Full Name
interleukin-11 isoform 1
NCBI Official Synonym Full Names
interleukin 11
NCBI Official Symbol
IL11
NCBI Official Synonym Symbols
AGIF; IL-11
NCBI Protein Information
interleukin-11; adipogenesis inhibitory factor; oprelvekin
UniProt Protein Name
Interleukin-11
Protein Family
UniProt Gene Name
IL11
UniProt Synonym Gene Names
IL-11; AGIF
UniProt Entry Name
IL11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

Uniprot Description

IL11: Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Belongs to the IL-6 superfamily.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Cytokine; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; cytokine activity; interleukin-11 receptor binding

Biological Process: fat cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; cell-cell signaling; megakaryocyte differentiation; B cell differentiation; negative regulation of hormone secretion; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation

Research Articles on IL11

Similar Products

Product Notes

The IL11 il11 (Catalog #AAA6153049) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL11 (Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL11 il11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.