Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IFNGR2 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human IFNGR2 Monoclonal Antibody | anti-IFNGR2 antibody

IFNGR2 (Interferon gamma Receptor 2, IFN-gamma Receptor 2, IFN-gamma-R2, Interferon gamma Receptor Accessory Factor 1, AF-1, Interferon gamma Transducer 1, IFNGT1) (PE)

Gene Names
IFNGR2; AF-1; IFGR2; IFNGT1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFNGR2; Monoclonal Antibody; IFNGR2 (Interferon gamma Receptor 2; IFN-gamma Receptor 2; IFN-gamma-R2; Interferon gamma Receptor Accessory Factor 1; AF-1; Interferon gamma Transducer 1; IFNGT1) (PE); anti-IFNGR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D9
Specificity
Recognizes human IFNGR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IFNGR2 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa28-127 from human IFNGR2 (NP_005525.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IFNGR2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IFNGR2 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-IFNGR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,806 Da
NCBI Official Full Name
interferon gamma receptor 2
NCBI Official Synonym Full Names
interferon gamma receptor 2 (interferon gamma transducer 1)
NCBI Official Symbol
IFNGR2
NCBI Official Synonym Symbols
AF-1; IFGR2; IFNGT1
NCBI Protein Information
interferon gamma receptor 2; IFN-gamma-R2; IFN-gamma receptor 2; interferon gamma transducer 1; interferon gamma receptor beta chain; interferon gamma receptor accessory factor 1; interferon gamma receptor accessory factor-1
UniProt Protein Name
Interferon gamma receptor 2
Protein Family
UniProt Gene Name
IFNGR2
UniProt Synonym Gene Names
IFNGT1; IFN-gamma receptor 2; IFN-gamma-R2; AF-1
UniProt Entry Name
INGR2_HUMAN

NCBI Description

This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. [provided by RefSeq, Jul 2008]

Uniprot Description

IFNGR2: Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD); also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity, whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Belongs to the type II cytokine receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: endoplasmic reticulum; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interferon-gamma receptor activity

Biological Process: cell surface receptor linked signal transduction; response to virus; cytokine and chemokine mediated signaling pathway

Disease: Immunodeficiency 28

Research Articles on IFNGR2

Similar Products

Product Notes

The IFNGR2 ifngr2 (Catalog #AAA6158334) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFNGR2 (Interferon gamma Receptor 2, IFN-gamma Receptor 2, IFN-gamma-R2, Interferon gamma Receptor Accessory Factor 1, AF-1, Interferon gamma Transducer 1, IFNGT1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNGR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFNGR2 ifngr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNGR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.