Mouse IFI16 Monoclonal Antibody | anti-IFI16 antibody

IFI16 (Interferon, gamma-Inducible Protein 16, IFNGIP1, MGC9466, PYHIN2) (AP)

Cat. Num. AAA6162833

• Gene Names: IFI16; PYHIN2; IFNGIP1
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: IFI16; Monoclonal Antibody; IFI16 (Interferon; gamma-Inducible Protein 16; IFNGIP1; MGC9466; PYHIN2) (AP); Interferon; PYHIN2; anti-IFI16 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5C10
• Specificity: Recognizes IFI16.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 729

• Applicable Applications for anti-IFI16 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IFI16 (AAH17059, 630aa-729aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IFI16 monoclonal antibody (M06), clone 5C10 Western Blot analysis of IFI16 expression in Hela S3 NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IFI16 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-IFI16 antibody

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. [provided by RefSeq]

Product Categories/Family for anti-IFI16 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 16877622
• NCBI GeneID: 3428
• NCBI Official Full Name: Interferon, gamma-inducible protein 16
• NCBI Official Synonym Full Names: interferon gamma inducible protein 16
• NCBI Official Symbol: IFI16
• NCBI Official Synonym Symbols: PYHIN2; IFNGIP1
• NCBI Protein Information: gamma-interferon-inducible protein 16
• Protein Family: Gamma-interferon-inducible protein

NCBI Description

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2011]