Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IDO1 monoclonal antibody (M15), clone 1C5. Western Blot analysis of IDO1 expression in human liver.)

Mouse IDO1 Monoclonal Antibody | anti-IDO1 antibody

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (AP)

Gene Names
IDO1; IDO; INDO; IDO-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
IDO1; Monoclonal Antibody; IDO1 (Indoleamine 2; 3-dioxygenase 1; CD107B; IDO; INDO) (AP); Indoleamine 2; INDO; anti-IDO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C5
Specificity
Recognizes IDO1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-IDO1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IDO1 (NP_002155, 304aa-403aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IDO1 monoclonal antibody (M15), clone 1C5. Western Blot analysis of IDO1 expression in human liver.)

Western Blot (WB) (IDO1 monoclonal antibody (M15), clone 1C5. Western Blot analysis of IDO1 expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IDO1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IDO1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IDO1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IDO1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-IDO1 antibody
Gamma-interferon (IFNG; MIM 147570) has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and Chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase (INDO; EC 1.13.11.52). This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. [supplied by OMIM]
Product Categories/Family for anti-IDO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.7 kDa (426aa), confirmed by MALDI-TOF
NCBI Official Full Name
indoleamine 2,3-dioxygenase 1
NCBI Official Synonym Full Names
indoleamine 2,3-dioxygenase 1
NCBI Official Symbol
IDO1
NCBI Official Synonym Symbols
IDO; INDO; IDO-1
NCBI Protein Information
indoleamine 2,3-dioxygenase 1
UniProt Protein Name
Indoleamine 2,3-dioxygenase 1
UniProt Gene Name
IDO1
UniProt Synonym Gene Names
IDO; INDO; IDO-1
UniProt Entry Name
I23O1_HUMAN

NCBI Description

This gene encodes indoleamine 2,3-dioxygenase (IDO) - a heme enzyme that catalyzes the first and rate-limiting step in tryptophan catabolism to N-formyl-kynurenine. This enzyme acts on multiple tryptophan substrates including D-tryptophan, L-tryptophan, 5-hydroxy-tryptophan, tryptamine, and serotonin. This enzyme is thought to play a role in a variety of pathophysiological processes such as antimicrobial and antitumor defense, neuropathology, immunoregulation, and antioxidant activity. Through its expression in dendritic cells, monocytes, and macrophages this enzyme modulates T-cell behavior by its peri-cellular catabolization of the essential amino acid tryptophan.[provided by RefSeq, Feb 2011]

Uniprot Description

INDO: Catalyzes the cleavage of the pyrrol ring of tryptophan and incorporates both atoms of a molecule of oxygen. Belongs to the indoleamine 2,3-dioxygenase family.

Protein type: Amino Acid Metabolism - tryptophan; Cell cycle regulation; EC 1.13.11.52; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p12-p11

Cellular Component: stereocilium bundle; smooth muscle contractile fiber; cytosol

Molecular Function: electron carrier activity; metal ion binding; heme binding; indoleamine 2,3-dioxygenase activity; tryptophan 2,3-dioxygenase activity

Biological Process: regulation of activated T cell proliferation; positive regulation of T-helper 2 type immune response; negative regulation of interleukin-10 production; positive regulation of chronic inflammatory response; tryptophan catabolic process to kynurenine; positive regulation of interleukin-12 production; response to lipopolysaccharide; female pregnancy; negative regulation of T cell proliferation; cytokine production during acute inflammatory response; multicellular organismal response to stress; tryptophan catabolic process; positive regulation of T cell tolerance induction

Research Articles on IDO1

Similar Products

Product Notes

The IDO1 ido1 (Catalog #AAA6163119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IDO1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IDO1 ido1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IDO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.