Mouse anti-Human ID3 Monoclonal Antibody | anti-ID3 antibody

ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (HRP)

Cat. Num. AAA6153008

• Gene Names: ID3; HEIR-1; bHLHb25
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ID3; Monoclonal Antibody; ID3 (1R21; BHLHB25; HEIR1; DNA-binding Protein Inhibitor ID-3; Class B Basic Helix-loop-helix Protein 25; Helix-loop-helix Protein HEIR-1; ID-like Protein Inhibitor HLH 1R21; Inhibitor of DNA Binding 3) (HRP); anti-ID3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G1
• Specificity: Recognizes human ID3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ID3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-83 form human ID3 (NP_002158) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.87kD).)

Western Blot (WB)

(ID3 monoclonal antibody Western Blot analysis of ID3 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged ID3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ID3 over-expressed 293 cell line, cotransfected with ID3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ID3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-ID3 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 156119621
• NCBI GeneID: 3399
• NCBI Accession #: NP_002158
• NCBI GenBank Nucleotide #: NM_002167
• UniProt Accession #: Q02535; O75641; A8K1T8
• Molecular Weight: 12,999 Da
• NCBI Official Full Name: DNA-binding protein inhibitor ID-3
• NCBI Official Synonym Full Names: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
• NCBI Official Symbol: ID3
• NCBI Official Synonym Symbols: HEIR-1; bHLHb25
• NCBI Protein Information: DNA-binding protein inhibitor ID-3
• UniProt Protein Name: DNA-binding protein inhibitor ID-3
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: ID3
• UniProt Synonym Gene Names: 1R21; BHLHB25; HEIR1
• UniProt Entry Name: ID3_HUMAN

NCBI Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011]

Uniprot Description

ID3: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors. Induced by phorbol 12-myristate 13-acetate (PMA). Interacts with COPS5 and COPS7A. Homodimer, and heterodimer with other HLH proteins.

Protein type: Transcription, coactivator/corepressor; DNA-binding

Chromosomal Location of Human Ortholog: 1p36.13-p36.12

Cellular Component: microtubule cytoskeleton; nucleoplasm; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein domain specific binding; protein binding; transcription factor binding; transcription factor activity; transcription corepressor activity

Biological Process: circadian rhythm; muscle development; central nervous system development; transcription, DNA-dependent; positive regulation of apoptosis; regulation of cell cycle; heart development; multicellular organismal development; negative regulation of transcription factor activity; negative regulation of transcription from RNA polymerase II promoter; notochord development; neuron differentiation; odontogenesis; epithelial cell differentiation; response to wounding; negative regulation of osteoblast differentiation; negative regulation of myoblast differentiation; negative regulation of transcription, DNA-dependent; metanephros development; regulation of DNA replication