Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ICT1 is 0.3 ng/ml as a capture antibody.)

Mouse ICT1 Monoclonal Antibody | anti-ICT1 antibody

ICT1 (Immature Colon Carcinoma Transcript 1, DS-1) (AP)

Gene Names
MRPL58; DS1; DS-1; ICT1; MRP-L58
Applications
ELISA
Purity
Purified
Synonyms
ICT1; Monoclonal Antibody; ICT1 (Immature Colon Carcinoma Transcript 1; DS-1) (AP); Immature Colon Carcinoma Transcript 1; DS-1; anti-ICT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C10
Specificity
Recognizes ICT1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ICT1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ICT1 (NP_001536, 107aa-206aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ICT1 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ICT1 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-ICT1 antibody
The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq]
Product Categories/Family for anti-ICT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,630 Da
NCBI Official Full Name
peptidyl-tRNA hydrolase ICT1, mitochondrial isoform 1
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L58
NCBI Official Symbol
MRPL58
NCBI Official Synonym Symbols
DS1; DS-1; ICT1; MRP-L58
NCBI Protein Information
peptidyl-tRNA hydrolase ICT1, mitochondrial
UniProt Protein Name
Peptidyl-tRNA hydrolase ICT1, mitochondrial
UniProt Gene Name
ICT1
UniProt Synonym Gene Names
DS1; MRP-L58; DS-1
UniProt Entry Name
ICT1_HUMAN

NCBI Description

The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

ICT1: Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes. Belongs to the prokaryotic/mitochondrial release factor family. ICT1 subfamily.

Protein type: Mitochondrial; EC 3.1.1.29

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial large ribosomal subunit

Molecular Function: aminoacyl-tRNA hydrolase activity; translation release factor activity, codon nonspecific

Biological Process: mitochondrial translation; organelle organization and biogenesis

Research Articles on ICT1

Similar Products

Product Notes

The ICT1 ict1 (Catalog #AAA6161616) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ICT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ICT1 ict1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ICT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.