Mouse HTRA2 Monoclonal Antibody | anti-HTRA2 antibody

HTRA2 (HtrA Serine Peptidase 2, OMI, PARK13, PRSS25) (PE)

Cat. Num. AAA6183946

• Gene Names: HTRA2; OMI; MGCA8; PARK13; PRSS25
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: HTRA2; Monoclonal Antibody; HTRA2 (HtrA Serine Peptidase 2; OMI; PARK13; PRSS25) (PE); HtrA Serine Peptidase 2; PRSS25; anti-HTRA2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G5
• Specificity: Recognizes HTRA2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 458

• Applicable Applications for anti-HTRA2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HTRA2 (AAH00096, 359aa-458aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HTRA2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HTRA2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(HTRA2 monoclonal antibody (M03), clone 3G5 Western Blot analysis of HTRA2 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged HTRA2 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-HTRA2 antibody

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq]

Product Categories/Family for anti-HTRA2 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 12652695
• NCBI GeneID: 27429
• NCBI Official Full Name: HtrA serine peptidase 2
• NCBI Official Synonym Full Names: HtrA serine peptidase 2
• NCBI Official Symbol: HTRA2
• NCBI Official Synonym Symbols: OMI; MGCA8; PARK13; PRSS25
• NCBI Protein Information: serine protease HTRA2, mitochondrial
• Protein Family: Serine protease

NCBI Description

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]