Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human HTATIP2 Monoclonal Antibody | anti-HTATIP2 antibody

HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (FITC)

Gene Names
HTATIP2; CC3; TIP30; SDR44U1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HTATIP2; Monoclonal Antibody; HTATIP2 (CC3; TIP30; Oxidoreductase HTATIP2; 30kD HIV-1 TAT-interacting Protein; HIV-1 TAT-interactive Protein 2) (FITC); anti-HTATIP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
4G8
Specificity
Recognizes human HTATIP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HTATIP2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-242 from HTATIP2 (AAH02439) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-HTATIP2 antibody
Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.
Product Categories/Family for anti-HTATIP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,131 Da
NCBI Official Full Name
Homo sapiens HIV-1 Tat interactive protein 2, 30kDa, mRNA
NCBI Official Synonym Full Names
HIV-1 Tat interactive protein 2, 30kDa
NCBI Official Symbol
HTATIP2
NCBI Official Synonym Symbols
CC3; TIP30; SDR44U1
NCBI Protein Information
oxidoreductase HTATIP2; 30 kDa HIV-1 TAT-interacting protein; HIV-1 TAT-interactive protein 2; Tat-interacting protein (30kD); short chain dehydrogenase/reductase family 44U, member 1
Protein Family

Research Articles on HTATIP2

Similar Products

Product Notes

The HTATIP2 (Catalog #AAA6147687) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HTATIP2 (CC3, TIP30, Oxidoreductase HTATIP2, 30kD HIV-1 TAT-interacting Protein, HIV-1 TAT-interactive Protein 2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTATIP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HTATIP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HTATIP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.