Mouse anti-Human HSPB1 Monoclonal Antibody | anti-HSPB1 antibody

HSPB1 (Heat Shock Protein beta-1, HspB1, Heat Shock 27kD Protein, HSP 27, Stress-responsive Protein 27, SRP27, Estrogen-regulated 24kD Protein, 28kD Heat Shock Protein, HSPB1, HSP27) (PE)

Cat. Num. AAA6158284

• Gene Names: HSPB1; CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HSPB1; Monoclonal Antibody; HSPB1 (Heat Shock Protein beta-1; HspB1; Heat Shock 27kD Protein; HSP 27; Stress-responsive Protein 27; SRP27; Estrogen-regulated 24kD Protein; 28kD Heat Shock Protein; HSP27) (PE); anti-HSPB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G3
• Specificity: Recognizes human HSPB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HSPB1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa96-205 from human HSPB1 (NP_001531) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSPB1 expression in transfected 293T cell line by HSPB1 monoclonal antibody. Lane 1: HSPB1 transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSPB1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of HSPB1 transfected lysate using HSPB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSPB1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HSPB1 is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between AKT1 and HSPB1. Mahlavu cells were stained with AKT1 rabbit purified polyclonal 1:1200 and HSPB1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Product Categories/Family for anti-HSPB1 antibody

Antibodies; Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4504517
• NCBI GeneID: 3315
• NCBI Accession #: NP_001531
• NCBI GenBank Nucleotide #: NM_001540
• UniProt Accession #: P04792; Q6FI47; Q96C20; Q96EI7; Q9UC31; Q9UC34; Q9UC35; Q9UC36; B2R4N8
• Molecular Weight: 22,783 Da
• NCBI Official Full Name: heat shock protein beta-1
• NCBI Official Synonym Full Names: heat shock protein family B (small) member 1
• NCBI Official Symbol: HSPB1
• NCBI Official Synonym Symbols: CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102
• NCBI Protein Information: heat shock protein beta-1
• UniProt Protein Name: Heat shock protein beta-1
• Protein Family: Heat shock protein
• UniProt Gene Name: HSPB1
• UniProt Synonym Gene Names: HSP27; HSP28; HspB1; HSP 27; SRP27
• UniProt Entry Name: HSPB1_HUMAN

NCBI Description

This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. [provided by RefSeq, Aug 2017]

Uniprot Description

HSP27: a small heat shock protein that is regulated both transcriptionally and posttranslationally. Modulates actin polymerization and reorganization. Its expression level increases several-fold in response to stress and is phosphorylated by MAPKAP kinase 2. Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock.

Protein type: Chaperone; Motility/polarity/chemotaxis; Heat shock protein

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: proteasome complex; extracellular space; focal adhesion; cytoskeleton; cytoplasm; plasma membrane; spindle; cytosol; Z disc; nucleus

Molecular Function: protein kinase C inhibitor activity; identical protein binding; ubiquitin binding; protein binding; protein kinase C binding; protein kinase binding

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; response to virus; positive regulation of blood vessel endothelial cell migration; response to unfolded protein; positive regulation of interleukin-1 beta production; retinal homeostasis; positive regulation of angiogenesis; negative regulation of protein kinase activity; gene expression; vascular endothelial growth factor receptor signaling pathway; cell motility; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of translational initiation; negative regulation of apoptosis

Disease: Neuronopathy, Distal Hereditary Motor, Type Iib; Charcot-marie-tooth Disease, Axonal, Type 2f