Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STCH monoclonal antibody. Western Blot analysis of STCH expression in NIH/3T3.)

Mouse anti-Human, Mouse HSPA13 Monoclonal Antibody | anti-HSPA13 antibody

HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (AP)

Gene Names
HSPA13; STCH
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSPA13; Monoclonal Antibody; HSPA13 (Heat Shock 70kD Protein 13; Stress 70 Protein Chaperone Microsome-associated 60kD Protein; Microsomal Stress 70 Protein ATPase Core; STCH) (AP); anti-HSPA13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H8
Specificity
Recognizes human STCH. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
471
Applicable Applications for anti-HSPA13 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa375-471 from human STCH (NP_008879) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(STCH monoclonal antibody. Western Blot analysis of STCH expression in NIH/3T3.)

Western Blot (WB) (STCH monoclonal antibody. Western Blot analysis of STCH expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged STCH is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged STCH is ~1ng/ml as a capture antibody.)
Related Product Information for anti-HSPA13 antibody
STCH is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. This protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein.
Product Categories/Family for anti-HSPA13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
heat shock 70 kDa protein 13
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 13
NCBI Official Symbol
HSPA13
NCBI Official Synonym Symbols
STCH
NCBI Protein Information
heat shock 70 kDa protein 13
UniProt Protein Name
Heat shock 70 kDa protein 13
Protein Family
UniProt Gene Name
HSPA13
UniProt Synonym Gene Names
STCH
UniProt Entry Name
HSP13_HUMAN

NCBI Description

The protein encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein. [provided by RefSeq, Jul 2008]

Uniprot Description

HSPA13: Has peptide-independent ATPase activity. Belongs to the heat shock protein 70 family.

Protein type: Heat shock protein

Chromosomal Location of Human Ortholog: 21q11

Cellular Component: intracellular membrane-bound organelle; endoplasmic reticulum

Molecular Function: ATP binding

Research Articles on HSPA13

Similar Products

Product Notes

The HSPA13 hspa13 (Catalog #AAA6131765) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPA13 hspa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPA13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.