Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)

Mouse anti-Human HSBP1 Monoclonal Antibody | anti-HSBP1 antibody

HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP) (AP)

Gene Names
HSBP1; NPC-A-13
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSBP1; Monoclonal Antibody; HSBP1 (Heat Shock Factor-binding Protein 1; Nasopharyngeal Carcinoma-associated Antigen 13; NPC-A-13; HSF1BP) (AP); anti-HSBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human HSBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HSBP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-76 from human HSBP1 (AAH07515) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)
Related Product Information for anti-HSBP1 antibody
Heat shock factor binding protein 1 (HSBP1) is a 76aa protein that binds to heat shock factor 1 (HSF1), which is a transcription factor involved in the HS response. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulated HSF1 DNA-binding activity.
Product Categories/Family for anti-HSBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
8,544 Da
NCBI Official Full Name
Homo sapiens heat shock factor binding protein 1, mRNA
NCBI Official Synonym Full Names
heat shock factor binding protein 1
NCBI Official Symbol
HSBP1
NCBI Official Synonym Symbols
NPC-A-13
NCBI Protein Information
heat shock factor-binding protein 1; nasopharyngeal carcinoma-associated antigen 13

NCBI Description

The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response. [provided by RefSeq, Jul 2008]

Research Articles on HSBP1

Similar Products

Product Notes

The HSBP1 (Catalog #AAA6131752) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSBP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.