Western Blot (WB)
(Western Blot detection against Immunogen (47.12kD).)
Mouse anti-Human HPCAL4 Monoclonal Antibody | anti-HPCAL4 antibody
HPCAL4 (Hippocalcin-like Protein 4, HLP4) APC
Gene Names
HPCAL4; HLP4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HPCAL4; Monoclonal Antibody; HPCAL4 (Hippocalcin-like Protein 4; HLP4) APC; anti-HPCAL4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11
Specificity
Recognizes human HPCAL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HPCAL4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-192 from human HPCAL4 (AAH30827) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (47.12kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (47.12kD).)
Western Blot (WB)
(Western Blot analysis of HPCAL4 expression in transfected 293T cell line by HPCAL4 monoclonal antibody. Lane 1: HPCAL4 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HPCAL4 expression in transfected 293T cell line by HPCAL4 monoclonal antibody. Lane 1: HPCAL4 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged HPCAL4 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HPCAL4 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-HPCAL4 antibody
May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.
Product Categories/Family for anti-HPCAL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
22,202 Da
NCBI Official Full Name
Homo sapiens hippocalcin like 4, mRNA
NCBI Official Synonym Full Names
hippocalcin like 4
NCBI Official Symbol
HPCAL4
NCBI Official Synonym Symbols
HLP4
NCBI Protein Information
hippocalcin-like protein 4
Protein Family
NCBI Description
The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Research Articles on HPCAL4
Similar Products
Product Notes
The HPCAL4 (Catalog #AAA6137044) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HPCAL4 (Hippocalcin-like Protein 4, HLP4) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPCAL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HPCAL4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HPCAL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
