Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (54.34kD).)

Mouse anti-Human HOXC9 Monoclonal Antibody | anti-HOXC9 antibody

HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (Biotin)

Gene Names
HOXC9; HOX3; HOX3B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXC9; Monoclonal Antibody; HOXC9 (Homeobox Protein Hox-C9; Homeobox Protein Hox-3B; HOX3B) (Biotin); anti-HOXC9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B12
Specificity
Recognizes human HOXC9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HOXC9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-260 from human HOXC9 (AAH53894) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (54.34kD).)

Western Blot (WB)

(Western Blot analysis of HOXC9 expression in transfected 293T cell line by HOXC9 monoclonal antibody. Lane 1: HOXC9 transfected lysate (29.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXC9 expression in transfected 293T cell line by HOXC9 monoclonal antibody. Lane 1: HOXC9 transfected lysate (29.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HOXC9 antibody
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product Categories/Family for anti-HOXC9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,248 Da
NCBI Official Full Name
Homo sapiens homeobox C9, mRNA
NCBI Official Synonym Full Names
homeobox C9
NCBI Official Symbol
HOXC9
NCBI Official Synonym Symbols
HOX3; HOX3B
NCBI Protein Information
homeobox protein Hox-C9; homeo box C9; homeobox protein Hox-3B
Protein Family

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq, Jul 2008]

Research Articles on HOXC9

Similar Products

Product Notes

The HOXC9 (Catalog #AAA6142340) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.