Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human HOXC8 Monoclonal Antibody | anti-HOXC8 antibody

HOXC8 (Homeobox Protein Hox-C8, Homeobox Protein Hox-3A, HOX3A) APC

Gene Names
HOXC8; HOX3; HOX3A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXC8; Monoclonal Antibody; HOXC8 (Homeobox Protein Hox-C8; Homeobox Protein Hox-3A; HOX3A) APC; anti-HOXC8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G1
Specificity
Recognizes human HOXC8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HOXC8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa47-136 from human HOXC8 (NP_073149-) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged HOXC8 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXC8 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-HOXC8 antibody
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product Categories/Family for anti-HOXC8 antibody
References
1. Ratio of miR-196s to HOXC8 Messenger RNA Correlates with Breast Cancer Cell Migration and Metastasis. Li Y, Zhang M, Chen H, Dong Z, Ganapathy V, Thangaraju M, Huang S.Cancer Res. 2010 Oct 15;70(20):7894-904. Epub 2010 Aug 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,755 Da
NCBI Official Full Name
homeobox protein Hox-C8
NCBI Official Synonym Full Names
homeobox C8
NCBI Official Symbol
HOXC8
NCBI Official Synonym Symbols
HOX3; HOX3A
NCBI Protein Information
homeobox protein Hox-C8; Hox-3.1, mouse, homolog of; homeo box 3A; homeo box C8; homeobox protein Hox-3A
UniProt Protein Name
Homeobox protein Hox-C8
Protein Family
UniProt Gene Name
HOXC8
UniProt Synonym Gene Names
HOX3A
UniProt Entry Name
HXC8_HUMAN

Uniprot Description

HOXC8: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: microtubule cytoskeleton; nucleoplasm

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: neuron differentiation; anterior/posterior pattern formation; transcription, DNA-dependent; skeletal morphogenesis; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The HOXC8 hoxc8 (Catalog #AAA6137036) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXC8 (Homeobox Protein Hox-C8, Homeobox Protein Hox-3A, HOX3A) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC8 hoxc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.