Immunoprecipitation (IP)
(Immunoprecipitation of HOXC8 transfected lysate using anti-HOXC8 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HOXC8 MaxPab rabbit polyclonal antibody.)
Mouse HOXC8 Monoclonal Antibody | anti-HOXC8 antibody
HOXC8 (Homeobox C8, HOX3, HOX3A) (APC)
Gene Names
HOXC8; HOX3; HOX3A
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
HOXC8; Monoclonal Antibody; HOXC8 (Homeobox C8; HOX3; HOX3A) (APC); Homeobox C8; HOX3A; anti-HOXC8 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H2
Specificity
Recognizes HOXC8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HOXC8 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXC8 (NP_073149, 47aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of HOXC8 transfected lysate using anti-HOXC8 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HOXC8 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of HOXC8 transfected lysate using anti-HOXC8 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with HOXC8 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-HOXC8 antibody
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq]
Product Categories/Family for anti-HOXC8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,755 Da
NCBI Official Full Name
homeobox protein Hox-C8
NCBI Official Synonym Full Names
homeobox C8
NCBI Official Symbol
HOXC8
NCBI Official Synonym Symbols
HOX3; HOX3A
NCBI Protein Information
homeobox protein Hox-C8; Hox-3.1, mouse, homolog of; homeo box 3A; homeo box C8; homeobox protein Hox-3A
UniProt Protein Name
Homeobox protein Hox-C8
Protein Family
UniProt Gene Name
HOXC8
UniProt Synonym Gene Names
HOX3A
UniProt Entry Name
HXC8_HUMAN
Uniprot Description
HOXC8: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.
Protein type: DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 12q13.3
Cellular Component: microtubule cytoskeleton; nucleoplasm
Molecular Function: sequence-specific DNA binding; transcription factor activity
Biological Process: neuron differentiation; anterior/posterior pattern formation; transcription, DNA-dependent; skeletal morphogenesis; negative regulation of transcription from RNA polymerase II promoter
Similar Products
Product Notes
The HOXC8 hoxc8 (Catalog #AAA6168517) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXC8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC8 hoxc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
