Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.22kD).)

Mouse anti-Human HOXC5 Monoclonal Antibody | anti-HOXC5 antibody

HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC)

Gene Names
HOXC5; CP11; HOX3; HOX3D
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXC5; Monoclonal Antibody; HOXC5 (Homeobox Protein Hox-C5; Homeobox Protein CP11; Homeobox Protein Hox-3D; HOX3D) (FITC); anti-HOXC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E10
Specificity
Recognizes human HOXC5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HOXC5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-68 from human HOXC5 (NP_061826) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.22kD).)

Testing Data

(Detection limit for recombinant GST tagged HOXC5 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXC5 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-HOXC5 antibody
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product Categories/Family for anti-HOXC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,976 Da
NCBI Official Full Name
homeobox protein Hox-C5
NCBI Official Synonym Full Names
homeobox C5
NCBI Official Symbol
HOXC5
NCBI Official Synonym Symbols
CP11; HOX3; HOX3D
NCBI Protein Information
homeobox protein Hox-C5; homeo box C5; homeobox protein CP11; homeobox protein Hox-3D
UniProt Protein Name
Homeobox protein Hox-C5
Protein Family
UniProt Gene Name
HOXC5
UniProt Synonym Gene Names
HOX3D
UniProt Entry Name
HXC5_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Subcellular location: Nucleus.

Sequence similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.

Research Articles on HOXC5

Similar Products

Product Notes

The HOXC5 hoxc5 (Catalog #AAA6147640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC5 hoxc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.