Mouse HOXC12 Monoclonal Antibody

HOXC12 (Homeobox Protein Hox-C12, Homeobox Protein Hox-3F, HOC3F, HOX3F)

Cat. Num. AAA646099

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: HOXC12; Monoclonal Antibody; HOXC12 (Homeobox Protein Hox-C12; Homeobox Protein Hox-3F; HOC3F; HOX3F); Anti -HOXC12 (Homeobox Protein Hox-C12; anti-HOXC12 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C6
• Specificity: Recognizes human HOXC12. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA

• Applicable Applications for anti-HOXC12 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-100 from human HOXC12 (NP_776272) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(HOXC12 monoclonal antibody Western Blot analysis of HOXC12 expression in PC-12.)

Western Blot (WB)

(HOXC12 monoclonal antibody Western Blot analysis of HOXC12 expression in Raw 264.7.)

Western Blot (WB)

(HOXC12 monoclonal antibody Western Blot analysis of HOXC12 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged HOXC12 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(HOXC12 monoclonal antibody Western Blot analysis of HOXC12 expression in NIH/3T3.)

Related Product Information for anti-HOXC12 antibody

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Product Categories/Family for anti-HOXC12 antibody

Antibodies; Abs to Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 13249232
• NCBI Official Full Name: HOXC12
• Protein Family: Homeobox protein

Uniprot Description

HOXC12: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Abd-B homeobox family.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development