Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.88kD).)

Mouse anti-Human HOXB1 Monoclonal Antibody | anti-HOXB1 antibody

HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I, MGC116843, MGC116844, MGC116845)

Gene Names
HOXB1; HOX2; HCFP3; HOX2I; Hox-2.9
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HOXB1; Monoclonal Antibody; HOXB1 (Homeobox Protein Hox-B1; Homeobox Protein Hox-2I; HOX2I; MGC116843; MGC116844; MGC116845); Anti -HOXB1 (Homeobox Protein Hox-B1; anti-HOXB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D1
Specificity
Recognizes human HOXB1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV
Applicable Applications for anti-HOXB1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-74 from human HOXB1 (NP_002135) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.88kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.88kD).)

Testing Data

(Detection limit for recombinant GST tagged HOXB1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXB1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-HOXB1 antibody
HOXB1 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It acts on the anterior body structures.
Product Categories/Family for anti-HOXB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32,193 Da
NCBI Official Full Name
HOXB1 protein
NCBI Official Synonym Full Names
homeobox B1
NCBI Official Symbol
HOXB1
NCBI Official Synonym Symbols
HOX2; HCFP3; HOX2I; Hox-2.9
NCBI Protein Information
homeobox protein Hox-B1; homeobox protein Hox-2I
UniProt Protein Name
Homeobox protein Hox-B1
Protein Family
UniProt Gene Name
HOXB1
UniProt Synonym Gene Names
HOX2I
UniProt Entry Name
HXB1_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.

Subcellular location: Nucleus.

Polymorphism: The two common alleles; HOX1B*A and HOX1B*B have a frequency of 78.8% and 21.2% respectively.

Involvement in disease: Facial paresis, hereditary congenital, 3 (HCFP3) [MIM:614744]: A form of facial paresis, a disease characterized by isolated dysfunction of the facial nerve (CN VII). HCFP3 patients are affected by bilateral facial palsy, facial muscle weakness of muscles innervated by CN VII, hearing loss, and strabismus.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7

Sequence similarities: Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.

Research Articles on HOXB1

Similar Products

Product Notes

The HOXB1 hoxb1 (Catalog #AAA6009355) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXB1 (Homeobox Protein Hox-B1, Homeobox Protein Hox-2I, HOX2I, MGC116843, MGC116844, MGC116845) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the HOXB1 hoxb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDYNRMNSFL EYPLCNRGPS AYSAHSAPTS FPPSSAQAVD SYASEGRYGG GLSSPAFQQN SGYPAQQPPS TLGV. It is sometimes possible for the material contained within the vial of "HOXB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.