Mouse anti-Human HOXA7 Monoclonal Antibody | anti-HOXA7 antibody

HOXA7 (Homeobox Protein Hox-A7, Homeobox Protein Hox 1.1, Homeobox Protein Hox-1A, HOX1A) (HRP)

Cat. Num. AAA6152933

• Gene Names: HOXA7; ANTP; HOX1; HOX1A; HOX1.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HOXA7; Monoclonal Antibody; HOXA7 (Homeobox Protein Hox-A7; Homeobox Protein Hox 1.1; Homeobox Protein Hox-1A; HOX1A) (HRP); anti-HOXA7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F2
• Specificity: Recognizes human HOXA7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HOXA7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa58-112 from HOXA7 (NP_008827) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.79kD).)

Western Blot (WB)

(Western Blot analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody Lane 1: HOXA7 transfected lysate (25.4kD). Lane 2: Non-transfected lysate)

Testing Data

(Detection limit for recombinant GST tagged HOXA7 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-HOXA7 antibody

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Product Categories/Family for anti-HOXA7 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

References

1. HOX gene analysis of endothelial cell differentiation in human bone marrow-derived mesenchymal stem cells. Chung N, Jee BK, Chae SW, Jeon YW, Lee KH, Rha HK.Mol Biol Rep. 2009 Feb;36(2):227-35. Epub 2007 Oct 30.

NCBI and Uniprot Product Information

• NCBI GI #: 24497556
• NCBI GeneID: 3204
• NCBI Accession #: NP_008827
• NCBI GenBank Nucleotide #: NM_006896
• UniProt Accession #: P31268
• Molecular Weight: 25kDa
• NCBI Official Full Name: homeobox protein Hox-A7
• NCBI Official Synonym Full Names: homeobox A7
• NCBI Official Symbol: HOXA7
• NCBI Official Synonym Symbols: ANTP; HOX1; HOX1A; HOX1.1
• NCBI Protein Information: homeobox protein Hox-A7
• UniProt Protein Name: Homeobox protein Hox-A7
• Protein Family: Homeobox protein
• UniProt Gene Name: HOXA7
• UniProt Synonym Gene Names: HOX1A
• UniProt Entry Name: HXA7_HUMAN

NCBI Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXA7: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.

Protein type: Motility/polarity/chemotaxis; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor binding

Biological Process: anterior/posterior pattern formation; transcription, DNA-dependent; negative regulation of keratinocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; angiogenesis; stem cell differentiation; negative regulation of cell-matrix adhesion; negative regulation of monocyte differentiation; negative regulation of transcription, DNA-dependent; negative regulation of leukocyte migration; embryonic skeletal morphogenesis